SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000017923 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000017923
Domain Number 1 Region: 3-109
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 9.42e-28
Family BAR domain 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000017923   Gene: ENSMGAG00000016458   Transcript: ENSMGAT00000018999
Sequence length 109
Comment pep:novel chromosome:UMD2:6:50372477:50399353:-1 gene:ENSMGAG00000016458 transcript:ENSMGAT00000018999 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VLQKLGKADETKDEQFEEYVQNFKRQEAEGSRLQRELRGYLAAIKGMQDASKKLTESLHE
VYEPDWYGREDVKMIGEKCDELWEDFHQKLVDGSLLTLDTYLGQFPDIK
Download sequence
Identical sequences G3UQI4
ENSMGAP00000017923 ENSMGAP00000017923

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]