SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000017957 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000017957
Domain Number 1 Region: 692-1046
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.08e-95
Family Phoshoinositide 3-kinase (PI3K), catalytic domain 0.0000000947
Further Details:      
 
Domain Number 2 Region: 518-688
Classification Level Classification E-value
Superfamily ARM repeat 6.91e-55
Family Phoshoinositide 3-kinase (PI3K) helical domain 0.0000351
Further Details:      
 
Domain Number 3 Region: 106-285
Classification Level Classification E-value
Superfamily Ubiquitin-like 6.07e-49
Family Ras-binding domain, RBD 0.0074
Further Details:      
 
Domain Number 4 Region: 327-487
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 5.72e-46
Family PLC-like (P variant) 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000017957   Gene: ENSMGAG00000004015   Transcript: ENSMGAT00000020502
Sequence length 1057
Comment pep:novel chromosome:UMD2:23:3614481:3633057:1 gene:ENSMGAG00000004015 transcript:ENSMGAT00000020502 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPPGIYCPMEFWSKGENQNIQVDFLLPTGIYLNLSVPCNASLGTIKQVVWKHAQYEPLYH
MLSDPEAYVFTCINQTAEQQELEDEQRRLCDIQPFLPVLRLVAREGDRVKKLINSQISLL
IGKGLHEFDSVQDPEVNDFRTKMCQFCEERAAKRQQLSWAAWMEYNFPLQLEPMAKGLGT
GLLHTPTKNIFVNVKFQSGGESFTFQISPNEFPITLMSYAVKKQATVFRHETMENPEDYT
LQVNGKYEYLYGNYPLYQFQYIRSCLHRGLTPHLTMVHSSTIIAMRDEQVNSIANPPKMA
VKPPPLPKKKPNYGSLWSLEQSFYIELVQGSKVNADERMKLVVQAGLFHGNEMLCKMVSS
SEVNVCSEPVWKQRLDFDINICDLPRMARLCFALYAVIEKAKKARSTKKKSKKAVKSVRQ
VGRRDCPIAWVNVMLFDYKDQLKTGECCLHMWSSFPDEKGELLNPMGTVQCNPNTESAAA
LVICFPNVASHPVYYPSFEQLLELGRNGEQPRSAPEDPEEQKLQLKEILERRSHTELYEH
EKDLVWKMRYDIRDQYPQALAKLLTITKWNKHEDVAQMISLLQTWPELPVLNALELLDFS
FPDRYVGSFAINSLKKLTDHELFQYLLQLVQVLKYESYLDCELTKFLLDRALSNRKIGHF
LFWHLRSEMHVPAVALRFGLILEAYCRGSTHHMKVLMKQGEALSKMKALNEFVKLSSPKA
TKPQAKEMMHVCMKQETYLEALSHLQSPLNPSIILTEVCVDQCTFMDSKMKPLWIVFNNE
ETGGGGVGIIFKNGDDLRQDMLTLQMIQLMDVLWKQEGLDLRMTPYGCLSTGDKTGLIEV
VMHSDTIANIQLNKSNMAATAAFNKDALLNWLKSKNPGDALEQAIEEFTLSCAGYCVATY
VLGIGDRHSDNIMIRETGQLFHIDFGHFLGNFKTKFGINRERVPFILTYDFVHVIQQGKT
NNSEKFERFRGYCEKAYMILRRHGPLFLHLFALMKAAGLPELSCSKDIQYLKDSLALGKT
DEEALKHFRLKFNEALRESWKTKVNWLAHNVSKDNRQ
Download sequence
Identical sequences G3UQL7
ENSMGAP00000017957 ENSMGAP00000017957

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]