SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000017984 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000017984
Domain Number 1 Region: 180-492
Classification Level Classification E-value
Superfamily Cysteine proteinases 1.16e-117
Family Transglutaminase core 0.0000000198
Further Details:      
 
Domain Number 2 Region: 37-178
Classification Level Classification E-value
Superfamily E set domains 3.04e-41
Family Transglutaminase N-terminal domain 0.00068
Further Details:      
 
Domain Number 3 Region: 623-721
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 1.97e-24
Family Transglutaminase, two C-terminal domains 0.002
Further Details:      
 
Domain Number 4 Region: 509-618
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 1.07e-17
Family Transglutaminase, two C-terminal domains 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000017984   Gene: ENSMGAG00000011669   Transcript: ENSMGAT00000020565
Sequence length 722
Comment pep:novel chromosome:UMD2:6:44059217:44066600:-1 gene:ENSMGAG00000011669 transcript:ENSMGAT00000020565 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QETNSVPRRMVPAAASMTPLAPSTCTTRWGAPDPKNDLSDRDLKVTKVDFLKSQNSVQHH
TDAYNTSNLVVRRGQPFLVQLTLSRELRASDKLSLHFSIGEKPKEPTGTLMSLNPRSTRN
VSGWQISIVKSSGTECTLSVTSAPNAAVGIYGLIVKTGPNVYKPEKNTVYLLFNPWCEGD
IVFLSNEAERKEYVLNDTGYIYVGSAFNIHSKPWNFGQFEESILDACMYLLDKSKLKMSS
RRDPVVVSRAMSALVNANDDSGVVLGNWSGKYENGTSPMAWIGSVAILQQYYKTKKPVSY
GQCWVFSGVLTTVMRCLGIPARSVSNFNSAHDTDENLRVDVYLNEKGEKLKWMSSDSVWN
FHVWNDVWMKRKDLPSGFDGWQAIDATPQEQSQGIFQCGPCPVKAVKDGDVYLPYDSKFV
YAEVNADKVYWRVKEENGRNKYTKLGVESQSIGANISTKAVGQNRREDITWQYKFPEGSS
EERASMKRAVSYLQPSGMTPRSRFAAVPLDLEITNEKPLCPGNPIEVVITVKSTVAGSWT
VDLASSCQLQSYTGKVHANLGYIKQTVKVEGQSEVRVPLKIMPEAYMKALATVDDEEHVH
VTAIAEIQGTPEKLTKEVSLSFEYPPIQVQMPETAQVNKDFTCAFIFKNKLNVPLDNCKL
MVEGLGIFKMATFDEGDIQPGRIIKSEVICTPTRVGEKKIVARLTSNQVKDISVEKGIMV
TH
Download sequence
Identical sequences G3UQP4
ENSMGAP00000017984 ENSMGAP00000017984

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]