SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000018044 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000018044
Domain Number 1 Region: 6-58
Classification Level Classification E-value
Superfamily PDZ domain-like 0.0000000000237
Family PDZ domain 0.00036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000018044   Gene: ENSMGAG00000017023   Transcript: ENSMGAT00000019102
Sequence length 301
Comment pep:novel chromosome:UMD2:8:5665179:5670930:-1 gene:ENSMGAG00000017023 transcript:ENSMGAT00000019102 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LPLTFAEITPGSKAAQSQMNQGDLVVAIDGVNTDSMTHLEAQNKIKSASYNLSLTLQKYV
YISPLNTGLAPLRLHLIGILKRKDKALNSNSHLPTKISLPSSRETAPLATVTKATAANFV
ESATKTCIIRKHRTAFAESTPLAGFVTSSIFNPLALFCHCCLFTSMFLHEYFELLITMQV
ELVRKMAVIFPMKIQSDLSGCSLWLCKTLDSSLKVQCGISKDSNDFEYIMDDFGSRTCCE
QSPSDVFLASVSVLQCKQFPERLYLFRGHRERFETERNSPRFAKLRNWHHGLSAQILNVK
S
Download sequence
Identical sequences G3UQV0
ENSMGAP00000018044 ENSMGAP00000018044

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]