SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000018103 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000018103
Domain Number 1 Region: 57-153
Classification Level Classification E-value
Superfamily PDZ domain-like 8.28e-25
Family PDZ domain 0.0000117
Further Details:      
 
Domain Number 2 Region: 450-540
Classification Level Classification E-value
Superfamily PDZ domain-like 6.57e-23
Family PDZ domain 0.0056
Further Details:      
 
Domain Number 3 Region: 266-312
Classification Level Classification E-value
Superfamily PDZ domain-like 0.00000302
Family PDZ domain 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000018103   Gene: ENSMGAG00000016391   Transcript: ENSMGAT00000019856
Sequence length 542
Comment pep:novel chromosome:UMD2:Z:36755305:36774448:1 gene:ENSMGAG00000016391 transcript:ENSMGAT00000019856 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKTAQALQRMWSHAVKKLRILRGHSSPEVKMPLILDKVISYKLIGFCVQQAPGMEELIWE
QYTVTLQKDSKRGFGIAVSGGRDNPHFENGETSIVISDVLPGGPADGLLQENDRVVIVNG
TPMENVPHSFAVQQLRKSGKVATIVVKRPRKVQATALRRSPSLDYEDRALDVMDDHAEFD
GKSARSGYSERSWRSGNGGRSQSWGNSLQCVCEHVKNKGIISLLKVQANYLSTCLYRWDS
TEIKKSLRLSLYTEFPCLIFLIVMLLIHNVVLEYGLRLGSQIFIKEMTSTGLATKDGNLH
EGDIILKFNAKITCLLTVYTCEKAHQQSQCMAHKKRLREWRLKNYLMTTCRENRGRIGQS
GRMKSNRRKLEHSYKRQHSPFSYTKILKEHSLFGNKSVGSKGQPYKLKNFIQKKVIQAYS
FSDRKKAEPNPVASSLLKLFVSKSKQKFHVIYPNTKMVRFKKGDSVGLRLAGGNDVGIFI
AGIQEGTSADQEGLQEGDQILKVNTQDFRGIVREDAVLYLLEIPKGDTVTILAQSKYEDY
RN
Download sequence
Identical sequences G3UR05
ENSMGAP00000018103 ENSMGAP00000018103

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]