SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000018333 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000018333
Domain Number 1 Region: 156-353
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 5.3e-52
Family BCR-homology GTPase activation domain (BH-domain) 0.00018
Further Details:      
 
Domain Number 2 Region: 39-149
Classification Level Classification E-value
Superfamily PH domain-like 8.66e-31
Family Pleckstrin-homology domain (PH domain) 0.0000431
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000018333   Gene: ENSMGAG00000000665   Transcript: ENSMGAT00000020402
Sequence length 661
Comment pep:novel chromosome:UMD2:24:273692:289498:-1 gene:ENSMGAG00000000665 transcript:ENSMGAT00000020402 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLKLPRNWDFNLKMEAAKIARSRSVMSGEAVTPQPGPPSAMERPLKLGWLKKQRSIVKN
WQQRYFVLRGQQLYYYKDEDDTKPQGCLSLQGSTIKEVASNPEEGGKFIFEIIPGLSGDQ
NRAGQDTCVLMASSQSDMEEWVKSIRRVLGSTSGAVFGQRLAETMAYEQKFGQHQVPILV
QKCAEFIREHGVNEEGIFRLPGQDNLVKQLRDAFDAGERPSFGRDTDVHTVASLLKLYLR
ELPEPVVPWMQYEDFLLCGQTLDVDQKKGHQDLLKQLSLLPRDNYNLLSYICRFLYEIQL
NSGVNKMSVDNLATVIGVNLIRPKMEDPATIMRGTLPIQKVMTVMISNHADLFPPSKDVP
PSPTAQQNDKKTPILRSSVGWDSAEDSTLPRAESSVQRKDNPSASCAPGRAVSSRAPSED
GVQPSKDTLGMWKMQARKRTQTLPNRKSFLTAASPGEKGSNDRNDIFNNDFWKGSTQSNP
RSVLTEGHKRTLSHDLFKLLDLHRASTYDSVPTSHVESSSSSPSPASSCSDKEFQPCPSP
CHQPPEPTSPASSPSEVFQPAPESKESLQNMVLKLQREMDAQKETYEEQIKSLEKENYDV
WAKVVRLNQDIEREKKKSEELELKLKNMERLQEDLEKKNKMLEEEIKTIAKSRSKSDAKT
N
Download sequence
Identical sequences G3URM3
ENSMGAP00000018333 ENSMGAP00000018333

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]