SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000018436 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000018436
Domain Number 1 Region: 966-1266
Classification Level Classification E-value
Superfamily Terpenoid cyclases/Protein prenyltransferases 9.67e-86
Family Complement components 0.0000318
Further Details:      
 
Domain Number 2 Region: 1338-1469
Classification Level Classification E-value
Superfamily Alpha-macroglobulin receptor domain 3.14e-35
Family Alpha-macroglobulin receptor domain 0.000048
Further Details:      
 
Domain Number 3 Region: 797-915
Classification Level Classification E-value
Superfamily E set domains 5.18e-23
Family SVA-like 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000018436   Gene: ENSMGAG00000013976   Transcript: ENSMGAT00000020172
Sequence length 1475
Comment pep:novel chromosome:UMD2:1:79965270:80004441:-1 gene:ENSMGAG00000013976 transcript:ENSMGAT00000020172 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNSFLGREMISFFCLTVRKMCLKFLLAILLLHATAGQEPELQYVLMVPAVLQSDSPSQVC
LQFFNLNQTVSVRVVLEYDTINTTIFEKNTTANNGLQCLNFTIPPVISVPLAFISFTAKG
TTFDLKERRSVMIWNMESFVFVQTDKPIYKPGQSVMFRVVALDFNFKPVQEMYPLIEIQD
PQSNRIFQWQNVTSEINIVQIEFPLAEEPILGNYKIIVVTKKSGERTNHSFLVEEYVLPK
FDVTFTAPGSLTVMDSELTVKICAVYTYGQPVEGKVQLSVCRDFDSYGRCKKSPVCQSFT
KDLDTDGCLSQVLSSKVFELNRIGYKRNLDMKATVTEKGTGLQLTATQSISITQVMSSLQ
FENVDHLYRRGIPYFGQIKLVDKDNSPISTKVIQLFVNNKNIHNFTTDVNGIAPFSIDTS
KMFDPELSLKAIYKTSDQCHSEGWIEPSYPDASLSVQRLYSWTSSFVRIDPLWKDMSCGQ
KRMITVYYILNTDGYENISIVNFYYVGMAKGKIVLTGEIKVNIQADQNGTFMIPLVVSEK
MAPALRLLVYMLHPAKELVADSVRFPIEKCFKNKVQLQFSQKEMLTTSNVSLVIEAAANS
FCAVRAVDKSVLLLKTETELSAETIYNLHPIQDLQGYIFNGFELEDDPQDPCISPDNIFH
KGLYYRPLTSGLGPDVYQFLRDMGMKFFTNSRIRQPVVCTSGTVRPPSYFLNSGFTASTH
HVKLSAEVAREERVKRHILETIREFFPETWIWNIVLINSTGKASVSYTIPDTVTEWKASA
FCVEESAGFGISVPATLTAFQPFFVDLTLPYSIIHGEDFLLRANVFNYLNHCIKINVLLS
ESPDYQTKLISPEDDGCVCTKKRKSYVWNISPKGIGEVFFSITAETNNDEACEEEALRNI
SIDYRDTQIRALLVEPEGIRREETQNSLICMKDDVITQDVVIDLPTNVVEGSPRVSFSVV
GDIMGTAMQNMHQLLLMPFGNGEQNMVLFAPNIYVLDYLNKTRQLSEDVKSKTIGYLVSG
YQKQLSYKHPDGSYSTFGVRDKEGNTWLTAFVYKSFAEASRFIFIDDNVQAQTLMWLARK
QKTDGCFQTAGILVNSALKGGVDNELSLSAYITIALLEAGHSLSYTVIRNAFYCLETVSE
KNISDIYTQALVTYAFCLAGKAEICESFLRELQKSAKEVDGSKYWEQKQRSPPEKSHLLD
HVPSNEVEITSYVLLALLYKPNHNQEDLTKASAIVQWIVRQQNPYGGFSSTQDTVVALQA
LAAYGEATYNSVTQNAIKITSKNTFEKVFTVNNENRLLLQQTPLPEVPGKYNLTVTGTGC
VLIQPVLRYNIYLPEGAFGFSLSVQTSNASCPQDQPGKFDIVLISSYTGKRSSSNMVVID
VKMLSGFVPVKSSLDKLIDAHTVMQVEYKKNHVLLYLENILQKKKKEVTFSVEQDFVVTH
PKPAPVQIYDYYVTAEEYAVAQYTSLCRDVVADMG
Download sequence
Identical sequences G3URW8
ENSMGAP00000018436 ENSMGAP00000018436

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]