SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000018526 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000018526
Domain Number 1 Region: 372-501,678-860
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 4.32e-48
Family p120GAP domain-like 0.017
Further Details:      
 
Domain Number 2 Region: 47-90
Classification Level Classification E-value
Superfamily E set domains 0.000012
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000018526   Gene: ENSMGAG00000016484   Transcript: ENSMGAT00000020143
Sequence length 893
Comment pep:novel chromosome:UMD2:1:20922275:20953622:-1 gene:ENSMGAG00000016484 transcript:ENSMGAT00000020143 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SQPCNVTEFGDEIVCVTGRNSKVEVVGVTMRYGETKIDVPVQFSYSENPTVTKFKPVNSF
SSGGRNITVTGTGFELIQSFSLMVHAERPEAGKLSSKTFVGNYVMRLNETTVVFSSLPIL
EDPENYNITTIILMDHYQLVVKNESHSFTYVADPTFENFTDGIKKQVNKLINAKGSNLNK
AMTIDEAQAFVGDEPCNIKTLTETDLYCEPPEVQPQPKKRQKRDMINNLPEFIVKFGLRE
WVLGRVEYDTRVSDIPLNLILPLVLIPMIAIIIISIICYRRKSQQAEREYEKIKSQLEGL
EESVRDRCKKEFTDLMIEMEDQTNDVNEAGIPVLDYKTYTDRVFFLPSKDGEKDVMITGK
LDIPEARRLTVEQALNQFSNLLNSKSFLINFIHTLENQREFSARAKVYFASLLTVALHGK
LEYYTDIMRTLFLELMEQYVVAKNPKLMLRRSETVVERMLSNWMSICLYQYLKDNAGEPL
YKLFKAIKHQVEKGPVDAVLKKAKYTLNDTGLLGDDVEYTQLTVNVYVQDGGTDSTPVKV
LNCDTISQVKEKIIDQVYRNLPCSQWPKADSVALEWRPGSTAQILSDLDLTSQRDGRWKR
INTLMHYNVRDGATLILSKMGISQQPEDSQQDVPGERHALLEDENKVWHLVRPVDEIDES
KSKRGSVKEKERTKAITEIYLTRLLSVKGTLQQFVDDFFHSVLNSNHVVPPAVKYFFDFL
DEQAEKHDIKDEDTIHIWKTNSLPLRFWVNILKNPHFIFDVHVHEVVDASLSTFMDACTR
TEHKLSRDSPSNKLLYAKEISNYKKMVEDYYKGIRQMVPVSDQDMNTHLAEISRAHTDSL
NTLVALHQLYQYTNKYYDEIINALEEDPAAQKMQLAFRLQQIAAALENKVTDL
Download sequence
Identical sequences G3US56
ENSMGAP00000018526 ENSMGAP00000018526

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]