SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000018590 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000018590
Domain Number 1 Region: 116-294
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 2.16e-38
Family BCR-homology GTPase activation domain (BH-domain) 0.000000534
Further Details:      
 
Domain Number 2 Region: 4-83
Classification Level Classification E-value
Superfamily SH3-domain 6.83e-17
Family SH3-domain 0.00000671
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000018590   Gene: ENSMGAG00000017409   Transcript: ENSMGAT00000018286
Sequence length 483
Comment pep:novel chromosome:UMD2:Z:23586422:23636461:1 gene:ENSMGAG00000017409 transcript:ENSMGAT00000018286 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSAEGYQYRALYDYKKEREEDIDLHFGDILTVNKGTLLALGFSEGEEAKPEEIGWLNGFN
ETTGERGDFPGTYVEYIGRKKIPPTPKPRPPRPLPVAPSPAKAEAESEQQAFSLPDLTEQ
FSPPDVAPPILIKIIETIENKGLECSTLYVTQSSSSSAELRQILECDASSLDLETFDVHT
LSDALKRYLLDLPNPIIPATVYSDVISVAQDVQSSEEYAQLLKKLIRSPNIPHQYWLTLQ
YLLKHFLRLCQASSKNLLNARSLAEIFSPLLFKYQIASSDNTEHHIKILETLITSEWNER
QPVPGKTTLRPPVPFYCCKISMEKNLSQSCPELCWSGSARAESQEKLHSTEQKTLLIQHL
TLEMEGIFGACLPKQGGESASHLFHSVGESDFEKTIQFNKIDVLFQKKKKSLAKYNISSL
PTLIKAFEKKYSEDQVVKEDSIEAVGKKLHEYNTQFQEKSREYDRLYEDYTRTSQKKKKK
NLL
Download sequence
Identical sequences G3USB8
ENSMGAP00000018590 ENSMGAP00000018590

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]