SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000018938 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000018938
Domain Number 1 Region: 3-486
Classification Level Classification E-value
Superfamily Sema domain 6.93e-55
Family Sema domain 0.0000000208
Further Details:      
 
Domain Number 2 Region: 482-533
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000000802
Family Plexin repeat 0.0027
Further Details:      
 
Domain Number 3 Region: 547-634
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000194
Family V set domains (antibody variable domain-like) 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000018938   Gene: ENSMGAG00000016522   Transcript: ENSMGAT00000020305
Sequence length 738
Comment pep:novel chromosome:UMD2:1:6000059:6069505:-1 gene:ENSMGAG00000016522 transcript:ENSMGAT00000020305 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EMLESNNIVNFNGLANSSSYHTFLLDEERSRLYVGAKDHIFSFNLVNIKEYQKLITWPVS
HSRRDECKWAGKDILRECANFIKVLKTYNQTHLYACGTGAFHPVCTYIEVGSHPEQSLTS
YCGFSFPNQRKKQYYSPSIPEISILHVSELNGGNSIDVYKLGEQFSLVILDKHFHKKTRM
HWNRLIYEVNFSSVHFPDIVNREGEKCWLIAVENCIQGAERSKTERKRTSQICYYQNKFE
KQHYSMFNKKITIKLINLLLDVSGILGIVTSKNSNEIVFFLSSMSKKKNIFYTKFTTDKS
LLRGSETCIWSFLNQTEIFLGNHRKTKEAKWAERLVHFPHHNPSTCQFLVLEQRNSSRLF
IAITLTITKSRRAIVQICFCVVNKRPSTKPNTDMKVLQIIVESAKSTKGNMDVKMITTAL
SARIKSFLVRRSKVRKLHRILVEELGIVHEWTVINIMKLVTEKQQQLYIGSATGVSQLPL
HRCDIYGKACAECCLARDPYCAWDGSSCSRYFPTAKRRTRRQDIRNGDPLTHCSDLQHHD
NPSGQTLEEKIIYGVENSSTFLECSPKSQRAIVYWQFQKQNDDHKVEIKVDDRMIRTEQG
LLLRSLQRRDSGIYFCHAVEHGFMQTLLKVTLEVIDTDHLEELLHKEEDGDASKTKDATN
SMTPSQKIWYRDFMQLINHPNLNTMDEFCEQVWKRDRKQRRQRPANAQVNTNKWKHLQEN
KKGRNRRTHEFERAPRSV
Download sequence
Identical sequences G3UT99
ENSMGAP00000018938 ENSMGAP00000018938

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]