SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000019223 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000019223
Domain Number 1 Region: 18-115
Classification Level Classification E-value
Superfamily DEATH domain 1.6e-20
Family Caspase recruitment domain, CARD 0.015
Further Details:      
 
Domain Number 2 Region: 1021-1161
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000000212
Family Nucleotide and nucleoside kinases 0.0032
Further Details:      
 
Domain Number 3 Region: 689-773
Classification Level Classification E-value
Superfamily PDZ domain-like 0.00000000945
Family PDZ domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000019223   Gene: ENSMGAG00000002976   Transcript: ENSMGAT00000019905
Sequence length 1166
Comment pep:novel chromosome:UMD2:16:3639911:3661160:-1 gene:ENSMGAG00000002976 transcript:ENSMGAT00000019905 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GGEPEMDDCLETLKDEEEALWENVECNRHMLSRYINPAKLTPYLRQCKVIDEQDEDEVLN
SLMLPSKINRAGRLLDILHTKGQRGYVVFLESLEFYYPELYKLVTGKEPTRRFSTIVVEE
GHEGLTHFLMNEIIKLQQQVKTKDMQRCDLLAKSRQLEDERKQLKLNKIELMTFQERYNK
MKEERNNYSDELVKVKDENYNLAMRYAQLSDEKSMAVMRSRDLQLEIDQLKHRLNKVEEE
CKLERNQSLKLKNDIENRPKKEQMLELERENEMMKTKIQELQSIIQADKRSLPDSDKAIL
DILEHDRKEALEDRHELVNKIFNLQEEIRHVEDLRDKYLEEKEDLELKCSTLGKDCEMYK
HRMNTVMIQLEEVEKERDQAFRSRDEAQTQYSHCLIEKDKYRKQIRELEERNDELRIEMV
RKEACIVNLECKLRRLSKDNNCHDQSLPRNLPITIISQTFGTSSPKANGQEADDSSTSED
SPEDNKFFLPDQARLKRRVNLKGIQINPRAKSPVSMNRTSEFQAVRAQDEDGADASNGRT
DNSSSNSVSISNSISSCEVSKIQTLRNRNDSIMSTTPEPPGNDSIVRRCKEDAPPCRCVA
VLLKRLCFVLLHFSDDSHDRHSHGAPSVHSSSSSHQSEGLDAYDLEHVNSIFRKFSLERP
FRPSVTSVGRIRNSCHTIQRITLNGDTLNSEITLIGGNDKGSFVSSVKSGSLAEKAGLRE
GHQLLLLEGCIKGENQSVPLDTCTKEEVHWTIQRCHGPVTLQYKSNHEGYRKLLSELEDG
LIASGDSFHIRLNLNISSQLDCCSLSVKCDEIVHILDTMYQGTCGGCDWLCARVDPFTDK
DLERGTIPSYSRAQQLLLVKLQRLMHRGSKDETDSSHNTLRALRNTLQPEEPAPQSDPKT
SPRLSRASFLLGQILQFVSRSENKYKRMNSNERVRIVTGWPSGLARTSSEAKKPLPDKLE
DLDSKSEINKRLIPYSLVRPIHCERRRPVLFTPTVLAKSLVQKLLNSGGALEFNICKPDI
VTKEELLRRQRTETIIFSREKNLSTYECIVPANIEAVTAKNKHCLLEAGISCTKDLIKAK
IYPIVLFIRVSEKNIKRFRKLLPKPEAEDEFLRMCRLKEKELEELPCLYASVEADTWSSI
EDLIRTIKDKIGEEQRKTIWIDEDQL
Download sequence
Identical sequences G3UTY6
ENSMGAP00000019223 ENSMGAP00000019223

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]