SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000019291 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000019291
Domain Number 1 Region: 21-118
Classification Level Classification E-value
Superfamily Immunoglobulin 6.93e-37
Family V set domains (antibody variable domain-like) 0.00018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000019291   Gene: ENSMGAG00000016931   Transcript: ENSMGAT00000020686
Sequence length 120
Comment pep:novel scaffold:UMD2:GL429037.1:246:768:1 gene:ENSMGAG00000016931 transcript:ENSMGAT00000020686 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRLHQTSMLCLSFPTGLMAAVTLDESGGGLQTPGGSLTLVCKASGFSFCSYNMFWVRQAP
GKGLEYVAAICRMVVPPNIGAALKGRATISRDNSQSTVKLQLNSLKAEDSATYYCAKCYG
Download sequence
Identical sequences H9H2I0
ENSMGAP00000019291 ENSMGAP00000019291

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]