SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000019357 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000019357
Domain Number 1 Region: 289-610
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 2.24e-89
Family p120GAP domain-like 0.0000892
Further Details:      
 
Domain Number 2 Region: 569-706
Classification Level Classification E-value
Superfamily PH domain-like 7.5e-46
Family Pleckstrin-homology domain (PH domain) 0.0016
Further Details:      
 
Domain Number 3 Region: 137-299
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 6.55e-26
Family Synaptotagmin-like (S variant) 0.028
Further Details:      
 
Domain Number 4 Region: 11-124
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.00000000000000748
Family Synaptotagmin-like (S variant) 0.075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000019357   Gene: ENSMGAG00000014839   Transcript: ENSMGAT00000020726
Sequence length 827
Comment pep:novel chromosome:UMD2:1:144216432:144315645:1 gene:ENSMGAG00000014839 transcript:ENSMGAT00000020726 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VFFFSFLSSGEAKNLPTYPGPNKMRDCYCTVNLDQEEVFRTKIVEKSLCPFYGEDFYCEI
PRTFRHLSFYXXXXXXXXXXXXTGKVAIQKEDLQKYHNRDTWFQLQHVDADSEVQGKVHL
ELRLSEVITDTGVVCHKLATRVLECQGLPIVNGQCDPYATVTLAGPSRSEAKKTKVKKKT
NNPHFDEVFYFEVTRPSSYNKKSQFDIEDVDEVDKMEIRVDLWNASNLKFGDEFLGELRL
PLKFLRQSSSYEAWYFLQPRDNGNKSLKPDDLGSLRLNVVYTEDHVFSSDYYSPLRDLLL
KSADVEPVSASAAHILGEVCREKQEAAIPLVRLFLHYGRIMPFISAIASAEVKRTQDPNT
IFRGNSLTSKCIDETMKLAGMHYLQVTLKPIIDEICQVHKPCEIDPVKLKDGENLENNRE
NLRQYVDRIFTVITKSGVSCPTVMCDIFFSLRESAAKRFQGDPDVRYTAVSSFIFLRFFA
PAILSPNLFQLTPHHPDPQTSRTLTLISKTIQTLGSLSKSKSANFKESYMATFYDYFNEQ
KYADAVKNFLDLISSSGRRDHKSIEQPILLKEGFMIKRAQGRKRFGMKNFKKRWFRLTNH
EFTYQKSKGDHPLCSIPIENILAVERLEEESFKMKNMFQVIQPERRVLYIQANNCVEAKD
WIDILTKVSQCNKKRLTVYHPSAYLNGHWLCCKATADNTPGCTPCTGGLPANIQLDIDGD
RETERIYSLFNLYMPKLEKMQEACGSKSVYDGPEEEEYSTFIIDDPKETYKTLKLIIEGV
GTLEQEHAQYKRDKFKKTKYGSQEHPIGDKSFQTYIRQQSEISAHSI
Download sequence
Identical sequences G3UU99
ENSMGAP00000019357 ENSMGAP00000019357

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]