SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000019395 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000019395
Domain Number 1 Region: 142-384
Classification Level Classification E-value
Superfamily vWA-like 1.01e-83
Family Integrin A (or I) domain 0.000000199
Further Details:      
 
Domain Number 2 Region: 643-731
Classification Level Classification E-value
Superfamily Integrin beta tail domain 3.53e-23
Family Integrin beta tail domain 0.00071
Further Details:      
 
Domain Number 3 Region: 357-473
Classification Level Classification E-value
Superfamily Integrin domains 5.75e-21
Family Integrin domains 0.001
Further Details:      
 
Domain Number 4 Region: 30-87
Classification Level Classification E-value
Superfamily Plexin repeat 0.000000000000235
Family Plexin repeat 0.0031
Further Details:      
 
Domain Number 5 Region: 601-641
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000502
Family Integrin beta EGF-like domains 0.0048
Further Details:      
 
Domain Number 6 Region: 559-597
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000106
Family Integrin beta EGF-like domains 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000019395   Gene: ENSMGAG00000006119   Transcript: ENSMGAT00000018739
Sequence length 803
Comment pep:novel chromosome:UMD2:6:14131172:14137822:1 gene:ENSMGAG00000006119 transcript:ENSMGAT00000018739 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VFQTNLTLLTWAGILCCLIWSGSAQQGGSDCIKANAKSCGECIQAGPNCGWCKKTDFLQE
GEPTSARCDDLAALKSKGCPEQDIENPRGSKRVLEDREVTNRKIGAAEKLKPEAITQIQP
QKLVLQLRVGEPQTFSLKFKRAEDYPIDLYYLMDLSYSMKDDLENVKSLGTALMHEMEKI
TSDFRIGFGSFVEKTVMPYISTTPAKLRNPCTGDQNCTSPFSYKNVLSLTSEGNKFNELV
GKQHISGNLDSPEGGFDAIMQVAVCGDQIGWRNVTRLLVFSTDAGFHFAGDGKLGGIVLP
NDGKCHLENNMYTMSHYYDYPSIAHLVQKLSENNIQTIFAVTEEFQAVYKELKNLIPKSA
VGTLSSNSSNVIQLIIDAYNSLSSEVILENSKLPKGVTISYKSYCKNGVNDTQEDGRKCS
NISIGDEVRFEINVTANECPKKGQNETIKIKPLGFTEEVEINLQFICDCLCQSEGEPNSP
ACHDGNGTFECGACRCNEGRIGRLCECSTDEVNSEDMDAYCRRENSTEICSNNGECICGQ
CVCKKRENTNEVYSGKYCECDNFNCDRSNGLICGGNGICKCRVCECFPNFTGSACDCSLD
TTPCLAANGQICNGRGTCECGTCNCTDPKFQGPTCEMCQTCLGVCAEHKDCVQCRAFDKG
EKKETCSQECMHFNMTRVESRDKLPQPGQPDPLSHCKEKDVDDCWFYFTYSVNSNGEANV
HVVETPECPSGPDIIPIVAGVVAGIVLIGLALLLIWKLLMIIHDRREFAKFEKEKMNAKW
DTGENPIYKSAVTTVVNPKYEGK
Download sequence
Identical sequences G1N3E3
ENSMGAP00000019395 ENSMGAP00000006227

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]