SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000019439 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000019439
Domain Number 1 Region: 52-157
Classification Level Classification E-value
Superfamily PDZ domain-like 8.94e-31
Family PDZ domain 0.0000263
Further Details:      
 
Domain Number 2 Region: 159-252
Classification Level Classification E-value
Superfamily PDZ domain-like 9.2e-27
Family PDZ domain 0.0000534
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000019439   Gene: ENSMGAG00000016846   Transcript: ENSMGAT00000019870
Sequence length 267
Comment pep:novel chromosome:UMD2:11:12373208:12415185:-1 gene:ENSMGAG00000016846 transcript:ENSMGAT00000019870 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LQKYRYQDEDTPPQEHSSPHIANEVTGPELVHVSEKNLSQIENVHGFVSHSHISPVKVNG
TDADYEYEEITLERGNSGLGFSIAGGTDNPHIGDDSGIFITKIIAGGAAAQDGRLRVNDC
ILRVNEVDVRDVTHSKAVEALKEAGSIVRLYVKRRKPVTEKVVEIKLVKGPKAGLGFSIA
GGVGNQHIPGDNSIYVTKIIEGGAAHKDGKLQIGDKLLAVNSVCLEEVTHEEAVTALKNT
SDFVYLKVAKPTSMFMNDSYAPPDITN
Download sequence
Identical sequences G3UUH5
ENSMGAP00000019439 ENSMGAP00000019439

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]