SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000019614 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000019614
Domain Number 1 Region: 4-185
Classification Level Classification E-value
Superfamily p53-like transcription factors 6.84e-76
Family Rel/Dorsal transcription factors, DNA-binding domain 0.00000000745
Further Details:      
 
Domain Number 2 Region: 180-303
Classification Level Classification E-value
Superfamily E set domains 1.47e-45
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.00000184
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000019614   Gene: ENSMGAG00000001721   Transcript: ENSMGAT00000020004
Sequence length 596
Comment pep:novel chromosome:UMD2:2:381261:410526:-1 gene:ENSMGAG00000001721 transcript:ENSMGAT00000020004 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GISEPYIEIFEQPRQRGMRFRYKCEGRSAGSIPGEHSTDNNKTFPSIQILNYFGKVKIRT
TLVTKNEPYKPHPHDLVGKDCRDGYYEAEFGPERRVLSFQNLGIQCVKKKDLKESISLRI
SKKINPFNVPEEQLHNIDEYDLNVVRLCFQAFLPDEHGNYTLALPPLISNPIYDNRAPNT
AELRICRVNKNCGSVKGGDEIFLLCDKVQKDDIEVRFVLDNWEAKGSFSQADVHRQVAIV
FRTPPFLRDITEPITVKMQLRRPSDQEVSEPMDFRYLPDEKDPYGNKAKRQRSTLAWQKL
IQDCGSAVTERPKAAPIPTVNPEGKLIKKEPNMFSPTLMLPGLGTLASSSQMYPACSQMP
TQPAQLGPGKQDTLHSCWQQLYSPSPSASSLLSMHSHNSFTAEVPQPGAQGSSSLPAYHD
NPLNWPDEKDSSFYRNFGNTNGMGAALVSAADMQSVSSSSIVQGTHQASATAASIMNMET
NDMNCTSLNFEKYTQMLNVSNHRQQLHQVPATCPPVAAPGSTPFSSQPNVADTAVYSSFL
DQEVLSDSRLSTNPLQNHQNSLTLTDNQFYDTDGVHTDELYQSFQLDTNILQSYNH
Download sequence
Identical sequences G5E7T6
ENSMGAP00000019614 ENSMGAP00000019614

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]