SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000019813 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000019813
Domain Number 1 Region: 708-1061
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 6.51e-94
Family Phoshoinositide 3-kinase (PI3K), catalytic domain 0.0000000869
Further Details:      
 
Domain Number 2 Region: 534-702
Classification Level Classification E-value
Superfamily ARM repeat 1.12e-57
Family Phoshoinositide 3-kinase (PI3K) helical domain 0.0000332
Further Details:      
 
Domain Number 3 Region: 113-294
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.91e-52
Family Ras-binding domain, RBD 0.0068
Further Details:      
 
Domain Number 4 Region: 333-496
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 8.83e-46
Family PLC-like (P variant) 0.0035
Further Details:      
 
Weak hits

Sequence:  ENSMGAP00000019813
Domain Number - Region: 18-60
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0961
Family Ubiquitin-related 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000019813   Gene: ENSMGAG00000004296   Transcript: ENSMGAT00000020403
Sequence length 1071
Comment pep:novel chromosome:UMD2:11:5108419:5157535:-1 gene:ENSMGAG00000004296 transcript:ENSMGAT00000020403 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DSIMPPAVTDSLDIWAVDSQIGADGSISVDFLLPTGIYINLDVPRDATISHIKQLLWKQA
HTYPLFHLLMEIDSYMFSCVNQTAVHEELEDETRRLCDVRPFLPVLKLVTRNCDPGEKLD
SKIGVLIGKGLHEFDALQDPEVNDFRAKMRRISEEKIQSLVGLSWMDWLKHTYPPEQEPV
VPENFQDKLYSGNLVVAVHFDNCQDVFSFQVSPNMNPIKLNELAIRKRLTIHGKEDEEID
PADYVLQVSGRLEYVFGDHPLIQFQYIHNCVMNRTLPQLTLVECCTIKKMCEQEMIAIEV
AINRKSSNLPLPLPPKKTRATTIHIFKNVCSPFKIILLKGNKLNTEENAKVHVRAGIFHG
TELLCKTIVSTEISGRSDHAWNEVLEFEINVCDLPRMARLCFAVYAVMDKMKTKKSTKSM
NPSKYQTIRKAGKVHYPVAWVNTMVFDYKGQLKNGEFVLHSWSSFPDELEEMLNPMGTVQ
TNPYTENATALHIRFQEYSKQPINYPPFDKILEKAAEIARSSDNAAMAGRGGKKFYVVLK
EIMERDPLSQLCENEMDLIWTLRYDCRENFPQSLPKLLLSLKWNKLEDVAQLQALLQIWP
KLLPREALELLDFNYPDQYVREYAVGCLKQMSDEELSQYLLQLVQVLKYEPFLDCALSRF
LLERALANRRIGQMLFWHLRSEVHIPAVSVQFGLILEAYCRGSVAHMKVLAKQVEALNKM
KTLNSLIKLNAMKQSKAKGKDAMHTCLKQNAYREALSDLQSPLNPSVILSELHVEKCKYM
DSKMKPLWIVYNNKMFGGDLVGIIFKNGDDLRQDMLTLQILRLMDVLWKEAGLDLRILPY
GCLATGDHSGLIEAVSSSETIADIQLNSSNVAAAAAFNKDALLNWLKEYNLGDDLDRAIE
EFTLSCAGYCVATYVLGIGDRHSDNIMVRKNGQLFHIDFGHILGNFKSKFGIKRERVPFI
LTYDFIHVIQQGKTGNTEKFGRFRQYCEEAYLILRKHGNLFITLFALMLTAGLPELTSVK
DIQYLKDSLALGKSEEEALKQFKQKFDEALRESWTTKVNWMAHTVRKDYRS
Download sequence
Identical sequences G5E801
ENSMGAP00000019813 ENSMGAP00000019813

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]