SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000001087 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMGAP00000001087
Domain Number - Region: 39-160
Classification Level Classification E-value
Superfamily E set domains 0.000532
Family Arrestin/Vps26-like 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000001087   Gene: ENSMGAG00000001614   Transcript: ENSMGAT00000001738
Sequence length 336
Comment pep:novel chromosome:UMD2:26:2659445:2666510:1 gene:ENSMGAG00000001614 transcript:ENSMGAT00000001738 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSFFGFGQSAEVELVLSDAESRRRVEHKTEEGKKEKYFLFYDGETVSGRVILTLKHPNRR
LEHQGIKVEFIGQIELYYDRGNHHEFVSLVKDLARPGEFTQSQIFDFEFTHVEKPYESYT
GQNVKLRYFLRATVSRRLNDVVKEMDIVVHTLSTYPELNSSIKMEVGIEDCLHIEFEYNK
SKYHLKDVIVGKIYFLLVRIKIKHMEIDIIKRETTGTGPNVYHENDTIAKYEIMDGAPVR
GESIPIRLFLAGYELTPTMRDINKKFSVRYYLNLVLIDEEERRYFKQQEVVLWRKGDIVR
KSMSHQAAIASQRFEGTSSHTEAKTPSQPAENNGRQ
Download sequence
Identical sequences F1NPH4 G1MS48
ENSMGAP00000001087 ENSGALP00000002310 ENSMGAP00000001087 XP_003212753.1.16129 XP_021231648.1.32913 XP_417878.1.86415

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]