SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000001458 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000001458
Domain Number 1 Region: 4-124
Classification Level Classification E-value
Superfamily Growth factor receptor domain 1.04e-17
Family Growth factor receptor domain 0.018
Further Details:      
 
Domain Number 2 Region: 121-170
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000614
Family EGF-type module 0.0081
Further Details:      
 
Weak hits

Sequence:  ENSMGAP00000001458
Domain Number - Region: 156-205
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000681
Family EGF-type module 0.021
Further Details:      
 
Domain Number - Region: 226-316
Classification Level Classification E-value
Superfamily Cadherin-like 0.0628
Family Cadherin 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000001458   Gene: ENSMGAG00000001940   Transcript: ENSMGAT00000002118
Sequence length 321
Comment pep:novel chromosome:UMD2:2:2264911:2279567:1 gene:ENSMGAG00000001940 transcript:ENSMGAT00000002118 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KDIDECATGTHNCRADQVCVNLRGSFSCQCPPGYQKRGEQCVDIDECTLPPYCHHRCVNT
PGSYYCQCNAGFQLASNNHTCVDINECDANNPCAQQCYNILGSFICQCNPGFELSSDRIN
CEDTDECRTSSYICQYQCVNEPGKFSCVCPEGYQVVGGRTCQDINECETTNECREDEICW
NYHGGFRCYPINPCQEPYVLTSENRCVCPVSNTICRELPYSVVYKYMSIRSDRTVPSDIF
QIQATTIYPNTINTFRIKSGNENGEFYLRQTSAVSAMLVLVKSLSGPREHIVDLEMLTVN
SLNYRTSSVLRLTIIVGPYAF
Download sequence
Identical sequences G1MSX1
ENSMGAP00000001458 ENSMGAP00000001458

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]