SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000002109 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000002109
Domain Number 1 Region: 6472-6733
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 8.4e-71
Family Protein kinases, catalytic subunit 0.00000377
Further Details:      
 
Domain Number 2 Region: 5894-6014
Classification Level Classification E-value
Superfamily PH domain-like 6.78e-32
Family Pleckstrin-homology domain (PH domain) 0.00066
Further Details:      
 
Domain Number 3 Region: 5689-5882
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 7.2e-31
Family DBL homology domain (DH-domain) 0.00027
Further Details:      
 
Domain Number 4 Region: 10-101
Classification Level Classification E-value
Superfamily Immunoglobulin 1.25e-23
Family I set domains 0.0058
Further Details:      
 
Domain Number 5 Region: 6016-6117
Classification Level Classification E-value
Superfamily Immunoglobulin 4.04e-23
Family I set domains 0.0042
Further Details:      
 
Domain Number 6 Region: 5135-5226
Classification Level Classification E-value
Superfamily Immunoglobulin 8.17e-23
Family I set domains 0.0053
Further Details:      
 
Domain Number 7 Region: 110-204
Classification Level Classification E-value
Superfamily Immunoglobulin 2.94e-22
Family I set domains 0.0065
Further Details:      
 
Domain Number 8 Region: 505-606
Classification Level Classification E-value
Superfamily Fibronectin type III 3.3e-22
Family Fibronectin type III 0.00037
Further Details:      
 
Domain Number 9 Region: 249-340
Classification Level Classification E-value
Superfamily Immunoglobulin 9.65e-22
Family I set domains 0.014
Further Details:      
 
Domain Number 10 Region: 4904-4997
Classification Level Classification E-value
Superfamily Immunoglobulin 1.24e-21
Family I set domains 0.0033
Further Details:      
 
Domain Number 11 Region: 4517-4626
Classification Level Classification E-value
Superfamily Fibronectin type III 5.34e-21
Family Fibronectin type III 0.00067
Further Details:      
 
Domain Number 12 Region: 2160-2253
Classification Level Classification E-value
Superfamily Immunoglobulin 6.89e-21
Family I set domains 0.013
Further Details:      
 
Domain Number 13 Region: 6110-6205
Classification Level Classification E-value
Superfamily Immunoglobulin 3.09e-20
Family I set domains 0.0079
Further Details:      
 
Domain Number 14 Region: 6369-6461
Classification Level Classification E-value
Superfamily Immunoglobulin 3.2e-20
Family I set domains 0.0049
Further Details:      
 
Domain Number 15 Region: 3444-3537
Classification Level Classification E-value
Superfamily Immunoglobulin 1.39e-19
Family I set domains 0.014
Further Details:      
 
Domain Number 16 Region: 2827-2913
Classification Level Classification E-value
Superfamily Immunoglobulin 5.2e-19
Family I set domains 0.0024
Further Details:      
 
Domain Number 17 Region: 3090-3183
Classification Level Classification E-value
Superfamily Immunoglobulin 5.75e-19
Family I set domains 0.019
Further Details:      
 
Domain Number 18 Region: 4075-4164
Classification Level Classification E-value
Superfamily Immunoglobulin 5.93e-19
Family I set domains 0.041
Further Details:      
 
Domain Number 19 Region: 5379-5477
Classification Level Classification E-value
Superfamily Immunoglobulin 1.24e-18
Family I set domains 0.011
Further Details:      
 
Domain Number 20 Region: 5268-5362
Classification Level Classification E-value
Superfamily Immunoglobulin 6.35e-18
Family I set domains 0.01
Further Details:      
 
Domain Number 21 Region: 1809-1894
Classification Level Classification E-value
Superfamily Immunoglobulin 7.11e-18
Family I set domains 0.026
Further Details:      
 
Domain Number 22 Region: 3894-3982
Classification Level Classification E-value
Superfamily Immunoglobulin 1.22e-17
Family I set domains 0.01
Further Details:      
 
Domain Number 23 Region: 2474-2560
Classification Level Classification E-value
Superfamily Immunoglobulin 1.32e-17
Family I set domains 0.016
Further Details:      
 
Domain Number 24 Region: 2284-2377
Classification Level Classification E-value
Superfamily Immunoglobulin 4.14e-17
Family I set domains 0.015
Further Details:      
 
Domain Number 25 Region: 3189-3276
Classification Level Classification E-value
Superfamily Immunoglobulin 4.36e-17
Family I set domains 0.022
Further Details:      
 
Domain Number 26 Region: 330-420
Classification Level Classification E-value
Superfamily Immunoglobulin 5.78e-17
Family I set domains 0.0045
Further Details:      
 
Domain Number 27 Region: 3355-3448
Classification Level Classification E-value
Superfamily Immunoglobulin 1.33e-16
Family I set domains 0.017
Further Details:      
 
Domain Number 28 Region: 3278-3364
Classification Level Classification E-value
Superfamily Immunoglobulin 1.56e-16
Family I set domains 0.018
Further Details:      
 
Domain Number 29 Region: 3805-3891
Classification Level Classification E-value
Superfamily Immunoglobulin 1.69e-16
Family I set domains 0.022
Further Details:      
 
Domain Number 30 Region: 1248-1343
Classification Level Classification E-value
Superfamily Immunoglobulin 2.16e-16
Family I set domains 0.0092
Further Details:      
 
Domain Number 31 Region: 3627-3716
Classification Level Classification E-value
Superfamily Immunoglobulin 3.11e-16
Family I set domains 0.028
Further Details:      
 
Domain Number 32 Region: 3978-4071
Classification Level Classification E-value
Superfamily Immunoglobulin 4.71e-16
Family I set domains 0.006
Further Details:      
 
Domain Number 33 Region: 3533-3625
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000118
Family I set domains 0.013
Further Details:      
 
Domain Number 34 Region: 4617-4702
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000155
Family I set domains 0.017
Further Details:      
 
Domain Number 35 Region: 1174-1258
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000172
Family I set domains 0.0097
Further Details:      
 
Domain Number 36 Region: 3009-3101
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000038
Family I set domains 0.013
Further Details:      
 
Domain Number 37 Region: 4255-4349
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000421
Family I set domains 0.009
Further Details:      
 
Domain Number 38 Region: 4438-4532
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000468
Family I set domains 0.016
Further Details:      
 
Domain Number 39 Region: 4156-4252
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000502
Family I set domains 0.054
Further Details:      
 
Domain Number 40 Region: 990-1072
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000851
Family I set domains 0.01
Further Details:      
 
Domain Number 41 Region: 1081-1164
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000851
Family I set domains 0.01
Further Details:      
 
Domain Number 42 Region: 1358-1440
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000144
Family I set domains 0.01
Further Details:      
 
Domain Number 43 Region: 1903-1989
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000213
Family I set domains 0.013
Further Details:      
 
Domain Number 44 Region: 1433-1527
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000271
Family I set domains 0.01
Further Details:      
 
Domain Number 45 Region: 2642-2734
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000471
Family I set domains 0.037
Further Details:      
 
Domain Number 46 Region: 3715-3802
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000562
Family I set domains 0.02
Further Details:      
 
Domain Number 47 Region: 898-981
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000659
Family V set domains (antibody variable domain-like) 0.069
Further Details:      
 
Domain Number 48 Region: 714-794
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000821
Family I set domains 0.0051
Further Details:      
 
Domain Number 49 Region: 2563-2651
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000182
Family I set domains 0.03
Further Details:      
 
Domain Number 50 Region: 2741-2830
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000195
Family I set domains 0.031
Further Details:      
 
Domain Number 51 Region: 2910-3003
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000223
Family I set domains 0.011
Further Details:      
 
Domain Number 52 Region: 1624-1705
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000268
Family I set domains 0.024
Further Details:      
 
Domain Number 53 Region: 1729-1804
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000323
Family I set domains 0.0092
Further Details:      
 
Domain Number 54 Region: 2085-2162
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000172
Family I set domains 0.0059
Further Details:      
 
Domain Number 55 Region: 1993-2075
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000264
Family I set domains 0.009
Further Details:      
 
Domain Number 56 Region: 809-885
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000437
Family I set domains 0.011
Further Details:      
 
Domain Number 57 Region: 429-520
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000196
Family I set domains 0.012
Further Details:      
 
Domain Number 58 Region: 4337-4432
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000034
Family I set domains 0.015
Further Details:      
 
Domain Number 59 Region: 2374-2468
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000253
Family I set domains 0.015
Further Details:      
 
Domain Number 60 Region: 620-682
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000003
Family I set domains 0.012
Further Details:      
 
Domain Number 61 Region: 5608-5669
Classification Level Classification E-value
Superfamily SH3-domain 0.00000431
Family SH3-domain 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000002109   Gene: ENSMGAG00000002499   Transcript: ENSMGAT00000002783
Sequence length 6736
Comment pep:novel chromosome:UMD2:6:1563755:1711488:-1 gene:ENSMGAG00000002499 transcript:ENSMGAT00000002783 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDYSSFSGVPRFLTRPKAFIVSVGKDATLSCQIIGNPIPVVSWEKDKLPIQSGGRFKTTE
DGDLYQLTIYDLSLEDSGQYICRAKNTIGEAFAAVSIKVGEETTVTESAPYFIQKPSSIK
VTLGEDAMFKCKVQGSPPLSVNWEKDGRHLRNRADAGRFQIESAGESNALTIQCARLGDS
GTYTCRAENPIGSASASAALVVESQGSSNPGSHFDTSCGKTSSLLSHLQKRREEITTKGA
RNAMFGTLTRSCSVTEGKHAKLSCYVTGEPKPEIVWKKDNEVIVEGRRHVIYEDDQENFV
LKILYCKQVDNGLYTCTASNLAGQTYSSVLVTVKEPPIPFKEKLKDLEVWEKESATFQCE
VPVPSTETSWFKEETKLRQSKKYNIEEEGTYRRLTVQNVTADDDAVYICEMKEGSRTIAE
LSVQGNIIKKLPRKTAVSVNDTAIFCVELDNECQNIRWLKNTEEVKPSDRISITRSGKQY
TMIIRECTMEDAGEIVFLADESRTSTQFTVTIPRKPPTQPPVDPVVKNKTETSVTLAWSP
PKMHRPIPIDGYVVERKKLTGFTWVRCHESHVPVPEFTVSNLSEEADYQFRVSAVNAHGQ
SPYLEFPGSVHLEPVLAVKSPLTTGEAVYGGDAMFTIDLTTTCSGTWYLNGKVLQESETC
IIKRTQTTHSLIIKNVTKNDDGAEVKFVAKNVDVSTKMRVRGAAVRFTNKSKDIEKISAR
LREEAKLQAELSDTDATVKWMKDGKELKANEKYELQTVGKRRILKIHNVAMEDAGTYQCI
CEGDKMLYQLSVKALANFINKEKTGGVIRAVAGKQAEFVSETSEANVMVKWYKNGKEITA
SKKFTMEDKGKLHKLVASAVTKEDEGTYICKIGDDTLIFDLKVSDEAVNFVNKPKTTPEI
SVSPSEDLELVCEVSAASGAVVWKKDQTEVKQDQRTTIISQGTHRKLIVKNVTLKDQGSY
SCETKDDKATFQVKVREKEDVFTNKEKVQKEVKAAATENATLSCEVAQDKTEVKWYKEGK
LITSSKKFRVESEGKLRRLVVSQVEKKDAGEYSCEAAGQKLTFRIHVTEAEDAFINKEKV
QKEVKAAATENATLSCEVAQDKTEVKWYKEGKLITSSKKFRVESEGKLRRLVVSQVEKKD
AGEYSCEAAGQKLTFKIHVTEAEDAFINKEKVQKEVKAAATENATLSCEVAQDKTEVKWY
KEGKPITSSKKFRVESEGKLRRLVVSQVEKKDAGEYSCEAAGQKLTFRIHVTEPEVVFTN
KEKVQKEVKAAATENATLSCEVAQDKTEVKWYKEGKPITSSKKFRVESEGKLRRLVVSQV
EKKDAGEYSCEAAGQKLTFRIHVTEAEDAFINKEKVQKEVKAAATENATLSCEVAQDKTE
VKWYKEGKLITSSKKFRVESEGKLRQLVVSQVEKKDAGEYSCEAAGRKLTFRIHVTEAED
AFINKEKVQKEVKAAATENATLSCEVAQDKTEVKWYKEGKLITSSKKFRVESEGKLRRLV
VSQVEKKDAGEYSCEAAGQKLTFRIHVTGCIWNDESATHSKRPDRAELSIPGTQSKISAN
HAQEQRTGLVRQKNRRLVMSKGTMKLQTYLCTLPATMLGYLSALGRNSGAFGCLEERCSL
VLHSEPKAVFINQEEVQKEVSAVLAESAALSCEVAQDTTEVKWYKDGRLLASSRKFKMET
VGKTRRLVVEQVEKKDAGEYICEAAGQKLTFKLEATEPEAKFGKEFVQKEPLIVQEHESI
TLTTSVTPETAVVKWYKDGREIKASKKYEIKSDGASRTLTVNLAESTDTAVYACQTKNDK
QEFKVEVKEIPVKFTKKLEAVKAEIGGSVTLSCEVSHAKGKVVWRRNAVEIKPSKRFQIH
EEGVRRTLTITGIRAEDEGEYFCESRDDKSSITITPKAPRVVKFVTSLNNVASEEGKEAV
FKCTVSPSDAVVTWFRNGVKIEASKKYVISQKDTNHSLTITDLTLEDAAEISANAEGVES
TANLRVREASISFKKKLEPKTVEERDTVTLEVELTKPGEVKWMRNSIVLKPSEKIEIKAE
GTKHILIVKDISFADRGFYCCESPDDKTQAKINVEMRQIKLVKGLQPLEVSEKGTVTFSV
EVSHEDVEGTWQKDGVRLKPAPNITMGVQGKKHSLTLSSVTLEDAGLVSFKAEGINSSGR
LTVIELPVKISKPLADISVTQKDKVTFECELSRPNVDVKWFKDGKELRQSKKVGITSQGN
KRSLIIHKCEYEDQGTYTCQAAEDKTSATLKVHAGKTYSLTYTRVQVKDAAEIKFVAEKA
ESRAHLTVKELPVKIVKPLRDKIALEKHRGFLECQVSRANAEVKWYKKDVEIHPSDKYEI
VSDGVYRKLIINDAGYEDEDTYTCDAFDDKSSAHFFVEEQSINIVKELCDEDVTEPEEAK
FECEISIPSVKPPKWYLRGEVLQPGRNIIMQQEGTIHRLTILKTSTDMTGTIQFSIGKSK
STANLLVRDYHIQITRKLEDKTALERHSVILSCDFRPSPKVVKWFKGHTPIEPSEKYKIK
RDKHSAELKILKLKPDDAGVYKCKAGIAETEATLTVEARNVEVTKHLQDVEVEEESSAVF
SCELSHDDEDVEWFLNGTLLYTNNYNDIKNVGSCYTLTMKQVKPEDAGTVTMKSDKVSES
ARLKVIEKPAVFMKSLDDVFGEERGVIKLECEVSKEKVKPVWKKDGVVLTSGNKYELVQS
GKTLCLLIHDLEKADAGLYTCDIGTDVAKSKVGVQELNIGITKRLKNTEIQEGEDCTFEC
ILSHESIGDFNWTLNGSRVESGGRFKASNVGRKYTLSIKSVIPADAGEVVFTARGLTSKA
SLSVKEKPTEVTKQLEDKTSAAGQDISLSCELSKPDVNIRWYKDGKAIRKSQKYDLQQEG
TKAILIIHDSTVKDSGEYTCETEDSKTKARVTVQEKPNYFIKELSDLKIEESGTAVFICQ
SEKAASSVIWRKGIAELRPGRKYEMTQKGRDLQLTIKNLEKSDGDTYTCDIGDAQSRAKL
VVQGQKVLITEDLEDVTVLEGESAMFKCRISPIEYSKVQWFLDKTPLHTNELNDIQSQPG
GYHLLTLKKLSLKDSGLITFEAGDKKTSASLVVKEKPCIFTKELVDTEVTEGKDVILHCE
TSKSDSPVKWCKDGKSLRNSSKYNISRSGFEAKLVIYGAEERDSGRYECEAGAAKSSAVI
TVKAISVLFEEELKSLEALEGGTATLHCQLSREAPVEWRKGHTVLRPSNKYRMRQEGTVA
ELLIHDLATKDAGDYTCVVGSQKTTATLSVNALPILFQEEMVDKEATEGQAVTLHCKLSK
SAPVEWRKGNKVLKPSEKYKIEQEGPFAELVIQDLDSADAGDYSCVCGNQQTTATLTVNV
LPTLFTKELSNEEATEGKSVSLCCELNKAAANVEWKKGLKTLKSSDKYKMKREGITAELL
IQNLDMTDAGNYSCVCGDQQTMAVLTVHALPAFFKEGLKNREATDGGTATLRCELSKVGV
PVEWKKGNKMLKSSDKYRMRQEETSAELLIRDLDVEDTGEYTCVCGDQKTSAVLTVHALP
ALFKKELVDVEATESGTAVLQCELTKSAPVEWRKGQESLKPSEKYKLRLKDTIAELIIQS
LEEQDAGDYTCVCGDKTTTASLTVHALPAYFKEEMKNEEATEGGTAMLQCELSRAVPVEW
KKKHKVLKLSEKYSMRQEGSTAQLLIHALEVKDAGEYTCVCGDKKTTAVLTVHALPALFK
EELRNEEATEGDVVTLRCELTKAAPVEWRKGHAVLKSTSEKYIMRQDDVLAELEIRELDL
QDAGDYTCVCGDHHTTASLTVNALPAVFKEELKNEEVVEGASVSLRCELSKAAPVQWKIG
PKVLKTSEKYQMSQPGTIAELVIRDLDVTDAGDYTCVCGDQKTTATLTVHDFAALPVTFK
QILQNKESEEGSTATFCCELSKPNAAVEWRKGGVGLQPDEKYEMRQRECLVELLIHNLQL
EDTGEYSCDTGDQETKASLHVKALPVLFKKELKDEEVEEGAAVKFQCELTKDNAAVEWRK
GTMEIFPCSKYEMRLSGCTAELVIHNAEPEDASDYTCDTGDQQSTAILRVNAIKPRLKQQ
LKNEEVEVGGTAKLRCEISISKAEVEWSKDGAVLHSSSKYEMWQQGTIRELRVHHLEPSD
AGEYSCKAGDETTSAKLTVKEPDVTIVSHLKDMVVFEGDDVTFQCQVSHENARDVEWKLQ
DVALQNNEMNEISVEKGKIHKLTLRKVTEQDLGTITFRVGPYTSTAELTVKEPAPTIVEM
LKDVTSYEGEDAVFECRLSQETTQDAQWFLGDVPLQSNEMNEIKVQGTRHTLILKKVTLE
DCGPISFKVGQHTTGAQLTVQAKNSIVQGLENVEAVEGGEALFECYLSKPECYNYNWLID
DEPAKTTENTEMVYFENGRRHLLLLKNLTLQDSCRVTFMCSDAVTSAFLTVKGWRLQILE
PLTDVEVSPGQKATFSCALSEAVPINEVTWYFNDIEIQPDEDWEIQADGNKYKLILNKAQ
PHHSGEVTFASREAIASAKLSVLAHPDPPEEPKVLRTSSHSVTLSWYKPLSDGGCDILGY
QVERKIPGVGWQSCNKSIIQGMELVVDNLTPGEPHRFRVSAVNKVGASEPAQFPQMVQLV
TEPSVTVTHPLVGGSVSEGEVARLECKLSSEIKENVTWLKGKEPIQTGGRYEILSDGKKQ
ILIIHAFKAEDQDTYTCMVSPEQMCKELKTCHLALFYEELVDGHVQPSLPPEAAQEGDLH
LLWEALAKKRRMSREPTLDSISEVPEEEEKLQKLRKEEAEQSHYYSEEYSTCDELARTGE
ADFSFTSSDDESRAGTPSLVNYLKKAEKRSVSVTTKVQSISSGKLWKQWEKSSVETVVAA
PGAKPVEPEIVDLDDPSMNSAAVKIQAAFKGYKVRKEIKQQECPVFTETFKDFSGEPGST
LHLECVAHSKTDMKVRWLKDGEELSDGRYYHIDNYSDGTCSLIITGLDRKDAGKYTCEAS
NKFGKVSHSAKVVIESTDSETESSSGSELDDAFRKAGRRLHRLFRSKISTEISDVEEELF
VSADEGDVEVVDHQTYREDDQYIYIKFEVLSEAKTAATRFREMFGALGIPVEIDILEQGP
RKVELRIGKATPPTHGKFAPPVLRPPPPLLTSDTAPMFLTELQNQEVQDGYPVSFDCIVV
GKPLPTVRWFKDGKAIEENDHYMINEDQEGCHQLIITAVVPTDMGVYRCLAENNMGVAST
KAELRVDLTSTDYETAADATETSSYYSAKEYVSSREQEESTTEEEQLPQILDDLHDIHVA
PGAPLAKFHLKVKGYPEPRLYWFKNGQPLKASDRILKIDRREFHSLEILNVMKSDAGQYS
IFLINSAGSAYSSARLVVRDPDEKEEESETDSHEQLIPPRFLERFTNKKVKKGASITLSV
KVEGHPPPTITWLKEESQEDILWIKPDTPGYKLASSNMHHSLILLDVKKKYSGAYTCIAT
NKAGQSICTANLEVADVKEAEVLTQERVMVSEAIMTTLGFLCTAEIFSHLGLITTHFRDL
EAGREGVPRTPISLADVGTEEFFQKLTSRISEMVSAKISQATLRVPGAESDDESKTPSAS
PRHGRSRPSSIAQESSSESEDGDSRGEIFDVYMVTADYVPPAPDKETITLKEGQYVEVLD
SAHPLKWLVRTKPTNPSRQGWVSPAYLDKRLKLSPEWGTTEVPEFPGEFVSEDEYKRKLS
VLIQELLISEEDYIQDLQFLQTHHLRYTETCPSVPGAIASQKSTIFRNIDDITRFHSSAF
LRGLQKCDTDDDVAMCFIKHEAEFNKYIQYLVGRVQAESIVVSKAVQDFYKRYTDEILMK
EDPSQTLIPPLQHYLEKPINRIQQYQTVIKELIRNKARNSQNCTLLEQAYAIVSALTRRA
ENNLHVSLIENYPGTLESLGEPIRQGHFIVWEGAPGARMAWKGHKRHVFLFRNYLVICKP
KRDTRTDTYSYIFKNIMKLNNIDVNDMVEGDDRAFEIWHEREDSVRKYLLQARTVNIKNS
WVKEICGIQQRISQPVWIPPDFEEELADCTAELGETVKLACKVTGAPRPSVSWYKDGKPV
EVDPHHIIIEDPDGSCTLILDNLTGVDSGQYMCFASSPAGNASTLGKILVQVPPRFVNKV
RNAYFVEGEDAQFTCTVEGAPRPQIRWYKDGILLKDTNKYQTFSEPRSGIIVLVVKNPSN
EDMGHYECELVNRLGSAKSGAELYHHTAAALTQERRGDQAITIEGMVLVQLFQQINSLNK
RLKCPRKPSSLFSVMTFSYHPCPSGASGLYEAMAPPPSGFYPKPAKEPRVPMPSLGLSHE
ETSTGAESTQERTVPISRLHERIPPAAGTGDWCRREGDVVWDVHSEVYIETTERTRVYKT
EEKTPTSPPYMQVTIEDVQVNSGERAKFQAVIEGTPPPTVLWFKGTTLLTDSVRLHQGKT
GTTYFLILDNVVSEDGGVYTCVAKNAGGEVLCKAELVVHEAKKDQAAKKVATRRKLHSLY
EVKQEIGRGCFSFVKRVVHKGNGVSCAAKFIPLRSKTKARAHQERDILSSLSHDRITRLL
DQFETRKTLILILELCSSEELLDRLFKKSVVTEAEVKLYIKQILEGINYLHDNNILHLDI
KPLNILMVYPEREDLKICDFGFAQKITPLEPQFSKYGSPEFVAPEIVSQSPVSKATDIWA
VGVITYLSLTCKSPFAGENDRGTLLNIQKGDVSWTAPDFVHLSEDAKDFIKRILQQQPRD
RPGALDCLSHRWFMVS
Download sequence
Identical sequences G1MUC1
ENSMGAP00000002109 ENSMGAP00000002109

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]