SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000002131 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000002131
Domain Number 1 Region: 55-263
Classification Level Classification E-value
Superfamily Terpenoid cyclases/Protein prenyltransferases 2.83e-40
Family Protein prenyltransferases 0.000000318
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000002131   Gene: ENSMGAG00000002540   Transcript: ENSMGAT00000002805
Sequence length 263
Comment pep:novel chromosome:UMD2:Z:78163748:78178678:-1 gene:ENSMGAG00000002540 transcript:ENSMGAT00000002805 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RKDSINLGHSYSKANWFNLYFLSFPESNLNRCGFRGSSYLGIPFNPSKGSDVSHPYDSGH
IAMTYTGLSCLLILGDDLSRINKDALLAGLRALQLEDGSQQFLHLEVHQASGGASGIWRC
LFHCSERSCYRYWTTSVVEKSLPYPKSNSIHPHLSCRGDGLASLGGGSTFCGIASLCLMG
KLEEVFSEKELSRIGRWCVMRQQNGYHGRPNKPVDTCYSFWVGATLKLLNLFQYTNFEKN
RNYILSTQDRLVGGFAKWPDSHP
Download sequence
Identical sequences G1MUD7
ENSMGAP00000002131 ENSMGAP00000002131

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]