SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000002160 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000002160
Domain Number 1 Region: 117-262
Classification Level Classification E-value
Superfamily PH domain-like 3.84e-20
Family Pleckstrin-homology domain (PH domain) 0.00017
Further Details:      
 
Weak hits

Sequence:  ENSMGAP00000002160
Domain Number - Region: 5-39
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 0.0636
Family Myotubularin-like phosphatases 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000002160   Gene: ENSMGAG00000002566   Transcript: ENSMGAT00000002834
Sequence length 277
Comment pep:novel chromosome:UMD2:1:624228:626192:1 gene:ENSMGAG00000002566 transcript:ENSMGAT00000002834 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KKAPVFFNYMYAPEDGEVLRPYSNISNLKVWDYYTEETLSEGPSYDWELVQGQPEHMEEA
DRQDTSAPQTKRKIIWPCYDNRSRMEPDAISKLLEDLHNLEMELGQIPERWKDTWDKIKA
SQRTEARQEGSRTPSSLLMPSGLSHHRRSLGVYLQESGVGSTLNLSLDSDTSSTSTPSSG
KQGGRRSTSTLYNQFHMSESENRSYEGSLYKKGAFMKPWKPRWFVLDKTKHQLRYYDSRM
DTECKGVIDLAEVESITPGTPTMGAPKTVDEKAFFDV
Download sequence
Identical sequences G1MUF7
ENSMGAP00000002160 ENSMGAP00000002160

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]