SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000002448 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000002448
Domain Number 1 Region: 3408-3550
Classification Level Classification E-value
Superfamily SET domain 2.22e-47
Family Histone lysine methyltransferases 0.0045
Further Details:      
 
Domain Number 2 Region: 1111-1181
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000000000117
Family PHD domain 0.0092
Further Details:      
 
Domain Number 3 Region: 1211-1279
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000000000465
Family PHD domain 0.0097
Further Details:      
 
Domain Number 4 Region: 1348-1412
Classification Level Classification E-value
Superfamily Bromodomain 0.0000432
Family Bromodomain 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000002448   Gene: ENSMGAG00000002737   Transcript: ENSMGAT00000003127
Sequence length 3553
Comment pep:novel chromosome:UMD2:26:4601003:4632549:-1 gene:ENSMGAG00000002737 transcript:ENSMGAT00000003127 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VRQSPRRIKPVRIIPSTKRTDATIAKQLLQRAKKGAQKKIEKEAAKLQGRKGRTQLKNIR
QFIMPVVSAISSRIIKTPKRFIEDEDYDPPIKISRLESTPNSRFSATSCGSSEKSSAASQ
HSSQMSSDSSRSSSPSVDTSTDSQASEEMQTLSEERSNTPEVHTPLPVSQSPENDNGDRR
NRRFSITERSFGQRAAKKLSALPSVPQQQSSSSPPPPLLTPPPPLQPASGISDHTPWLMP
PTIPLASPFLPTSAAPMQEKRKSILREPTFRWTSLKHSRSEPQYFSSAKYAKEGLIRKPI
FDNFRPPPLTPEDVGFASGFSTPGATAPARLFSLHSGTRFDMHKRSPLLRAPRFTPSEAH
SRIFESVTLPSSVGRTTTGTSATGVSSRKRKRKVFSPIRSEPRSPSHSMRTRSGRLSTSD
LTTLTPQSSVSSSLTSISVSSLATSALNSTFTFPSHSLTQSGESAERSQRQRKQTSTPAE
PFSSSSPTPLFPWFTTSPQTERGRNKDRATEELSKDKDADKSVEKDKSREKDREREKENK
RESRKEKRRKGSEIQSSSALFPVGKMPKEKVVSIIFCKKTAGRRKSTAIDPVADVSTAAL
VDTTAIKTKTSKKGRGGLDKSDLDLSPAVPSLEKEKALRLSTPASSTVKHSASSISSMLA
QADKLPMTDKRVASLLKKKAQLYKIEKSKSLKQADQPKAQGQESDSSETSVRGPRIKHVC
RRAAVALGRKRAVFPDDMPTLSALPWEEREKILSSMGNDDKSSIAGSEEAEPLAPPIKPI
KPVTRNKAQQEPPVKKGRRSRRCGQCSGCQVPEDCGVCTNCLDKPKFGGRNIKKQCCKMR
KCQNLQWMPSKAYLQKQAKAKKKEKKSKTNEKKESHSGKNQLDSGQKPTPPAVVPREDSA
VKKSSEPARKPVEEKHEDGNSSAPPPEPKQTPASGTRKTGKQTAQPVQLPPSQPPSSGPL
KKEAPKVTTSEPKKKQPPQPEIGTEQNKQKKIAPRPTFPVKQKPKEKEKPPPISKPENST
LNLLSTLTNGSSSKQKPPTDGVHRIRVDFKEDCEVENVWEMGGLGIVTSVPITPRVVCFL
CASSGHVEFVYCQVCCEPFHKFCLEESERPLEDQLENWCCRRCKFCHVCGRQHQATKQLL
ECNKCRNSYHPECLGPNYPTKPTKKKKVWICTKCVRCKSCGSTTPGKGWDAQWSHDFSLC
HDCAKLFAKGNFCPLCDKCYDDDDYESKMMQCGKCDRWVHSKCENLSDEMYEILSNLPES
VAYTCINCTEQHPAEWRLALEKELQVSLKQVLTALLNSRTTSHLLRYRQAAKPPDLNPET
EESIPSRSSPEGPDPPVLTEVSKQEEQQPLDMEGVKRKMDQGGYISVLDFSDDIVKIIQA
AINSDGGQPEIKKANSMVKSFFIRQMERVFPWFSVKKSRFWEPNKVTSNSGMLPNAVLPP
SLDHNYAQWQEREENNHTEQPPLMKKIIPAPKPKGPGEPDSPTPLHPPTPPISGSDRSRE
DSPELNPPPDVEDNRQCALCLKYGDDSANDAGRLLYIGQNEWTHVNCALWSAEVFEDDDG
SLKNVHMAVIRGKQLRCEFCQKSGATVGCCLTSCTSNYHFMCSRAKNCVFLDDKKVYCQR
HRDLIKGEVVPENGFEVLRRVFVDFEGISLRRKFLSGLEPENIHMMIGSMTIDCLGILND
LSDCEDKLFPIGYQCSRVYWSTTDARKRCVYTCKIMECRPPVVEPDINSTVEHDDNRTIA
HSPVPLTDNWYLTVFLGGKKPSDVNSCYYPTVSKGLRIRTPSYPSTQRSPGSRPLPSAVC
FGDMTHEIVTVGDPLLSSGLKSIGSRRHSTSSLSQQQSKLRMISPTRAGNTYSRHSLSSV
SSIGSSSEHEQSTKTADHFVGSVNSGTTSAPVQSCSSSSGSQKTAAASGTKTYQLDASQS
TEGKHPSSSDLVAKSAPSKGEKVKTLTSRDPDYSAHSFSSGGNSKTSTQPNSSSGTEINV
KIGTFQESAGSFSSKETVSFPSLHQRGPRKDRDQHLESVQPEKTTSVDEIDAKMLKSAGV
NSRSPAASEQVVSATRDRRQKGKKIVKESFKEKHSLKSLTDSSQAGGGDEGNLTSEFGNQ
GLVTEQISQRLCNNIPAEKNVEKSPPSQGSSKSSVVLPEVAPKESQAPRKRTVKVTLTPL
KMESEGQSKAAQQEGDAEPQPAGTELASSAEPSSNSESPEDNSVVQGSPNKAPTQESQNN
AYENLPVQDNNLMLQDGTKAQEEGSYKRRYPRRSARARSNMFFGLTPLYGVRSYGEEDIP
FYSNSTGKKRGKRSAEGQVDGADDLSTSDEDDLYYYNFTRTVVSSNTEERLASHNLFREE
EQCDLPKISQLDGVDDGTESDTSVTATTRKVNQVTKRSGKENGTENLKLDRTEESGEKVQ
VTKSPAVHKTDPKMDNCHPVSRVKTQGQDSLEAQDTFNTELLKSDSDNNNSDDCGNILPS
DIMDFVLKNTPSMQALGESPESSSSELLTLGEGLGLDSNRGKDMGLFEVFSQQLPTTEPV
DSSVSSSISAEEQFELPLELPSDLSVLTTRSPTVPSQNHNRLAVISESSLSSSGERSMLA
LPSTESGEKRVTVTEKSTSSEGDAALLSPGVDPSPEGHMTPDHFIQGHIDAEHIASPPCG
PVEQGHGSNQDLTRNSGTPGIQVPVSPTVPLQNQKYVPNSTDSPGASQISNAAVQTTPPH
LKPAAEKLLVVNQNMQPLYVLYSAQSVMETNASVLGPVGSGLTLTTGLNPSLPSSQSLYP
PTSKGLLPMSHHQHIHPFSTATQTGFPPNIGSPSPGLLIGVQPPPDPQLLVSEANQRTDL
GTTASTPAAALSKKRPISRLQSRKNKKLAPSGTPSAIAPPDMVSNMTLINFAPSQISNHP
LDLGXVMYFEQTSLLPQSGTASAVGTSPSVIGPDAGHLPTGPVSGLASSSSVLNVVSMQA
TAAPTTGGSVPSHVLGQSSVTLTSPGLLGDLGSISNLLIKASQQSLGLQEQHMTLPPASG
MFSQLGTSQTPSTAAMTAASSICVLPSAQSMSMTVAQSSTDPEGSYQLQHMTQLLASKTS
ATAQLSSFSQLVDVPNSTRLEQNKVSSSVMHASSASPGGSPSSGQQSASSSVLGSSKMKP
KIKRIQPSLEKGNGKKHKTSHMWTGSSEAHVPDRGTTAAPQVSAARTPAVKTDVQDAAST
DQPSQTQCGQSTGFWWPDLKKSVVKWLLSILHFHSLPSKGKRQFSQNLSQQRPQQQEQKR
KECLGEKKPKKGLVFEISSDDGFQICAESIEDAWKSLTDKVQEARSNARLKQLSFAGVNG
LRMLGIIHDTVVFLIEQLYGAKHCHNYKFRFHKPEEANEPPLNPHGSARAEVHLRKSAFD
MFNFLASKHRQPPEYNPNDEEEEEVQLKSARRATSMDLPMPMRFRHLKKTSKEAVGVYRS
PIHGRGLFCKRNIDAGEMVIEYSGNVIRSILTDKREKYYDSKGIGCYMFRIDDSEVVDAT
MHGNAARFINHSCEPNCYSRVINIDGQKHIVIFAMRKIYRGEELTYDYKFPIEDASNKLP
CNCGAKKCRKFLN
Download sequence
Identical sequences G1MV24
ENSMGAP00000002448 ENSMGAP00000002448

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]