SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000002903 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000002903
Domain Number 1 Region: 30-224
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.96e-43
Family DBL homology domain (DH-domain) 0.00024
Further Details:      
 
Domain Number 2 Region: 264-458
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 2.83e-31
Family BAR domain 0.016
Further Details:      
 
Domain Number 3 Region: 605-676
Classification Level Classification E-value
Superfamily SH3-domain 2.1e-17
Family SH3-domain 0.0006
Further Details:      
 
Domain Number 4 Region: 504-574
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000197
Family SH3-domain 0.00059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000002903   Gene: ENSMGAG00000003214   Transcript: ENSMGAT00000003593
Sequence length 687
Comment pep:novel chromosome:UMD2:15:8025587:8033420:-1 gene:ENSMGAG00000003214 transcript:ENSMGAT00000003593 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASTHAEEPLAEDTADHDAHIYEEVMLSERMEQSQRLAVEELITTEASYVHNLQLCLSDI
RAHLQKKQLPGLDLEGLFSNIDDILHVSRRFLRGLQDTAAQEHEQLLSISTLFQEFKEEM
EMVYKIYCASYEHALLLVESYRKDPRLQEEIMETLTTTVPHTSASDLSFFLVMPVQRVTK
YPLLLGKILENTPASTSTHAALAAAVRAMTQVNANINEYKRRREAATKYNKAEQLTLRDR
FARLNTHSIAKKTTRLSRLLMHEAGIVAKTEDKEYDDLEEKFQSVASSVAALKENVASYL
KHLERSFRLSENMYGGKLPCXGPAQQYRRLAEHLHCAVFPEFRRRLDRLVWQPLCSLAEM
LVGPQQLVKKRLDKLLDYEEIQERKSETGSVTYDEEAAMNTYLAINALLVAELPRFNQVA
MQLLGQLLGSFCVLQQDLAAEVLHETKKELEQMPHGHMLLPAFWRMVEDTLQQSGVQLCT
FIQAFETVTPSPVPQPLNSAEERKVLSLVSKHGPDKLYQVTSNISGSKDMDLTLQRGQIV
ALLQSVDTKGNKGRWLVDAGGPRGFVPAAKLQPYCLGPSQQPRMQMSALESGTERRRHSY
VSPEAPKPQVATFTPAFQVVAGFSFTARSPQELSLQAGQPVVVLEPHDKKGSTEWSLVEV
NGQRGYVPSSYLLTVPVQEPVGWSLPV
Download sequence
Identical sequences G1MW19
ENSMGAP00000002903 ENSMGAP00000002903

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]