SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000003425 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000003425
Domain Number 1 Region: 12-187
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.11e-45
Family G proteins 0.0000143
Further Details:      
 
Domain Number 2 Region: 190-228
Classification Level Classification E-value
Superfamily SOCS box-like 0.000000000275
Family SOCS box-like 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000003425   Gene: ENSMGAG00000003663   Transcript: ENSMGAT00000004127
Sequence length 279
Comment pep:novel chromosome:UMD2:20:3327576:3350434:1 gene:ENSMGAG00000003663 transcript:ENSMGAT00000004127 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RMSQAGSPGRAYDFLLKFLLVGDSDVGKGEILASLQDGAAESPYGYHMGIDYKTTTILLD
GRRIKLQLWDTSGQGRFCTIFRSYSRGAQGVILVYDITNRWSFDGIDRWIKEIDEHAPGV
PKILVGNRLHLAFKRQVSTEQAQTYAERLGMTFFEVSPLCNFNITESFTELARIVLMRHG
MDRLWRPNKVLSLQDLCCRAIVSCTPVHLVDKLPLPVALRSHLKSFSMANGLNARMMHGR
SYSLTSSNISKRNSLKKAKIIRLPQSPPKNCTRNSCKIA
Download sequence
Identical sequences G1MX77
ENSMGAP00000003425 ENSMGAP00000003425

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]