SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000003639 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000003639
Domain Number 1 Region: 33-246
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.35e-66
Family SPRY domain 0.0000000119
Further Details:      
 
Domain Number 2 Region: 235-272
Classification Level Classification E-value
Superfamily SOCS box-like 0.0000759
Family SOCS box-like 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000003639   Gene: ENSMGAG00000003896   Transcript: ENSMGAT00000004343
Sequence length 273
Comment pep:novel chromosome:UMD2:23:3490144:3495084:1 gene:ENSMGAG00000003896 transcript:ENSMGAT00000004343 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGQKVTGGIKTVDMRDPVYRPLKQELHRLDYSKPTRLDLLLDMPPVSYEVQLLHSWNNDD
RSLNVFVKEDDKLIFHRHPVAQSTDAIRGKVGYTRGLHVWQITWAMRQRGTHAVVGVATA
DAPLHSVGYTTLVGNNHESWGWDLGRNRLYHDGKNQPSKTYPAFLEPDETFIVPDSFLVV
LDMDDGTLSFIVDGQYMGVAFRGLKGKKLYPVVSAVWGHCEIRMRYLNGLDPEPLPLMDL
CRRAVRLALGKERLNEIPTLPLPASLKSYLLYQ
Download sequence
Identical sequences E1C5U4 G1MXP4
9031.ENSGALP00000003942 XP_004947506.1.86415 XP_004947507.1.86415 XP_021273338.1.32913 XP_021273340.1.32913 XP_021273341.1.32913 XP_417599.1.86415 ENSMGAP00000003639 ENSMGAP00000003639 ENSGALP00000003942

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]