SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000004079 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000004079
Domain Number 1 Region: 42-509
Classification Level Classification E-value
Superfamily Sema domain 8.5e-128
Family Sema domain 0.0000199
Further Details:      
 
Domain Number 2 Region: 1348-1477,1673-1769
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 5.89e-38
Family p120GAP domain-like 0.04
Further Details:      
 
Domain Number 3 Region: 949-1038
Classification Level Classification E-value
Superfamily E set domains 2.04e-16
Family Other IPT/TIG domains 0.045
Further Details:      
 
Domain Number 4 Region: 1037-1140
Classification Level Classification E-value
Superfamily E set domains 0.00000000000000713
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.058
Further Details:      
 
Domain Number 5 Region: 512-564
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000000288
Family Plexin repeat 0.0021
Further Details:      
 
Domain Number 6 Region: 853-937
Classification Level Classification E-value
Superfamily E set domains 0.00000000000955
Family Other IPT/TIG domains 0.0077
Further Details:      
 
Domain Number 7 Region: 1143-1217
Classification Level Classification E-value
Superfamily E set domains 0.00000322
Family E-set domains of sugar-utilizing enzymes 0.063
Further Details:      
 
Domain Number 8 Region: 808-845
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000157
Family Plexin repeat 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000004079   Gene: ENSMGAG00000004212   Transcript: ENSMGAT00000004791
Sequence length 1770
Comment pep:novel chromosome:UMD2:28:2737830:2822780:-1 gene:ENSMGAG00000004212 transcript:ENSMGAT00000004791 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDRRRTCPWALRSDGDGRSASLLCLLLASLSWSASSSTSFSTFHSEHRDWTFNHLTVHQS
TGAVYVGAINRVYKLSGNLTILVAHKTGPEEDNKSCYPPLIVQPCSEVLTLTNNVNKLLI
IDYSENRLLACGSLYQGVCKLLRLDDLFILVEPSHKKEHYLSSVNKTGTMYGVIVRSEGE
DGKLFIGTAVDGKQDYFPTLSSRKLPRDPESSAMLDYELHSDFVSSLIKIPSDTLALISH
FDIFYIYGFASGNFVYFLTVQPETPEGVSNSASDLFYTSRIVRLCKDDPKFHSYVSLPFG
CVRGDTEYRLLQAAYLSKPGDVLAKSLNITAQEDVLFAIFSKGQKQYHQPPDDSALCVFP
IRAVNAQIKDRLQSCYQGEGNLELNWLLGKDVQCTKAPVPIDDNFCGLDINQPLGGSVPV
DGVTLFTSSRDRMTSVASYIYNGYSVVFVGTKNGKVKKIRADGPPHGGIQYEVVTVFKDG
SPVLRDMAFSIDHKYLYVMSERQVSRVPVESCEQYTTCAECLSSGDPHCGWCTLHHTCSP
RDSCERADEPHRFADSIGQCMSIMVQPSSISVSQHSLPLSLLVSDAPDLAAGVTCLFGNL
TEVEGQVVGSRVVCVSPAARDVPAIPVDQDWFGVVLQLKSQETGRTFVSTEFKFYNCSAH
QLCLSCVNSAFRCHWCKYRNLCTHDPTTCSFQEGRINISEDCPQLFPTEEILIPVGEVKP
ITLKARNLPQPQSGQRGYECVLSIQGVIHRVPALRFNSSSVQCQNSSYLYDGMDISNLAV
DFAVVWNGNFVIDNPEDVKVHLYKCAAQRESCGLCLKADPKFECGWCSGEGRCTLRPHCS
PQPWLDWSSRNKCSNPRITEILTVSGPPEGGTRVTIRGINLGLDFSEIARGVQVAGVPCA
PLPEQYIIAEQIVCEMGQALPGISSGPVLLCIGECKPEFTAKSVQHYTFVTPTVSFLSPS
RGPESGGTLVTITGHHLGAGSHVSVLLGNQSCAFQGRSMNEIVCLSASSAHGLGPVHVSV
SIDRAQLEQTLMFEYIDDPKVQNIEPEWSIASGHTPLTITGSNLDIIQEPRIRVKHNGRE
SINVCVVLNATALSCLAPALAPEPRPTMDAVERPDEFGFIFNNVQSLRVYNDTKFIYYPN
PTFEPLSSTGMLEQKPGSPIILKGKNLCPPASGGAKLNYTVLVGETPCTVTVSETQLLCE
PPTLSGQHKVTVRVGGIIFSPGSVSITSDSLLTLPAIVSIAAGGSLLLIIVIIVLIAYKR
KSRENDLTLKRLQMQMDNLESRVALECKEAFAELQTDINELTSDLDRSGIPYLDYRTYAM
RVLFPGIEDHPVLRELEVQGNGQQSVEKALKLFAQLINNKVFLLTFIRTLELQRSFSMRD
RGNVASLIMTGLQGRLEYATDVLKQLLSDLIEKNLENKNHPKLLLRRTESVAEKMLTNWF
AFLLHKFLKECAGEPLFMLYCAIKQQMEKGPIDAITGEARYSLSEDKLIRQQIEYKTLIL
NCVNPDNENSPEIPVKVLNCDTITQVKEKILDAVYKNVPYSQRPRAVDMDLEWRQGRIAR
VVLQDEDITTKIEGDWKRLNTLLHYQVSDRSVVALVPKQTSSYNIPASASISRTSISRYD
STFRYTGSPDSLRSRAPMITPDLESGVKVWHLVKNHDHGDQKEGDRGSKMVSEIYLTRLL
ATKGTLQKFVDDLFETLFSTVHRGSALPLAIKYMFDFLDEQADKHGIHDTDVRHTWKSNC
LPLRFWVNVIKNPQFVFDIHKGSITDACLS
Download sequence
Identical sequences G1MYN6
ENSMGAP00000004079 ENSMGAP00000004079

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]