SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000006026 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000006026
Domain Number 1 Region: 106-289
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 3.4e-35
Family BAR domain 0.0076
Further Details:      
 
Domain Number 2 Region: 5-71
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 8.9e-21
Family DBL homology domain (DH-domain) 0.0011
Further Details:      
 
Domain Number 3 Region: 445-502
Classification Level Classification E-value
Superfamily SH3-domain 7.61e-17
Family SH3-domain 0.00023
Further Details:      
 
Domain Number 4 Region: 348-433
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000000158
Family SH3-domain 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000006026   Gene: ENSMGAG00000006039   Transcript: ENSMGAT00000006772
Sequence length 508
Comment pep:novel chromosome:UMD2:4:19551182:19566127:-1 gene:ENSMGAG00000006039 transcript:ENSMGAT00000006772 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GKPNLMDMGSLMIKPVQRVMKYPLLLCELLNSTPASHADHKALQEALSAMKNINVNINEL
KRRKDLVLKYKRNDDDETLKEKFSRLNIHSISKKSKRVTSHLKILTGGEPQVKDQTFNKE
EKLFRSLEKTVKSCVKNISLSLQHLQDSIHLAAQNITEIKSSSLEKTFSLTHQKLLSMCL
KNCENEMTQLDKVVLTPLSALQALFSGPQKLIQKRYDKLLDYNSYLQRSPGEELDLAKKD
YEALNAQLVEELQVFNRTAKKIVLNCLYCFITLLRSIMSAALQSNSAVVVPVPLSSSSIC
EVQHQLMEEVHKLNFMKENSSATFIERKLSLEKKKPVPSPLESPRQTEDHRSKLLSTYSA
ELLYQAKRKCNATQEFDIDLHEGEVVAVVEQKDPFQSTSRWLVDTGILKGYVYSSFLKPF
NPAKAQKDIAENNFCDDDFDNDMDDQHTFYAVYAFQARNDQELSLQEYEKVRILRFSDVS
GNKEWWLAEAKGQKGYVPSNYLGKMTYA
Download sequence
Identical sequences G1N2X8
ENSMGAP00000006026 ENSMGAP00000006026

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]