SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000006202 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000006202
Domain Number 1 Region: 2066-2126
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000000000208
Family RING finger domain, C3HC4 0.018
Further Details:      
 
Domain Number 2 Region: 826-1048
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000000000299
Family Type II thymidine kinase 0.077
Further Details:      
 
Domain Number 3 Region: 469-597,635-721
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000000000576
Family G proteins 0.09
Further Details:      
 
Weak hits

Sequence:  ENSMGAP00000006202
Domain Number - Region: 1623-1686
Classification Level Classification E-value
Superfamily A middle domain of Talin 1 0.0405
Family A middle domain of Talin 1 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000006202   Gene: ENSMGAG00000006182   Transcript: ENSMGAT00000006949
Sequence length 3276
Comment pep:novel chromosome:UMD2:20:5511540:5545109:1 gene:ENSMGAG00000006182 transcript:ENSMGAT00000006949 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ILCNCEREHCYIPSVFSQYKVHMIPQRPLTEIQQYLQHHYRVVQPSDSAACVFKGSSCVG
IVSSKRAGVGKSLYVKRLHERLEAQQPDCTELLKTIRLIEPAVDEDKVLHSLLPFLESQQ
PTKPMIFHFDITSSVQSGVPEFLFKLLVLQYLTDVKGNMWLRQKCHLYIIEILEVSPLPQ
QMVSASQKYNFLDVFPKVTCKSPKEVLEMETLGRQPRDASDPGMDEEEFHSEAFQRPFQY
LKRFDNGYNLDTFCYTEHSVEGSPAECLQIFLLHCGVVDPSWSEIRNFASFLNVQLRDCE
DSVFCNPEFVQDTLQGFKNFVVTFMILMARDFATPSLHISDQSSGRQSFNLENVSEDDLL
PFRIRKKWESEHHPYLFFNGDRVSMTFIGFHFQPNGAHGVDAINPLNGKIIKSNIMSLQL
YKGLLLQRVPFDISFDSLSRLEKLDRLCMVLGISYVTDPDETYELTTDNVLKMLAIEMRF
RCNIPVVIMGETGCGKTRLVNFLCKLRRSIVEVENMKLVKVHGGTTAEMIYARIKEAEVL
AIANKKLHGLDTVLFFDEANTTEAVSSIKEVLCDHTVEGKPLVSCSGLQIIAACNPYRKH
TPTMIQRLELAGLGYRVKADETKEKLGSIPLRQLVYRVHALPPSMIPLVWDFGQLNNLTE
KMYIQQIVQRVTEHIQVDQADMKVIAEVLIVSQEYMRQRDDECSFVSLRDVERCMEVFKW
FYKHSGLLLEQLEKYSEKKGGPKSPEEKGGLKSPERNNVIWSLVLAVGVCYHASLEKKEA
YRNAISKVLPEPYDTQKKILEEISLMQDLFLSGVQLRDTIARNLALKENVFMMVICIELK
IPLFLVGKPGSSKSLAKTIVADAMQGQAAHSDLFKDLKQTHLVSFQCSPLSTPEGIIGTF
KHCARFQDGKNLEEYVSVVVLDEIGLAEDSPKMPLKTLHPLLEDGCIDDDPLPHKKVGFI
GISNWALDPAKMNRGIFVSRGDPSKEELIESAKGICCSDRGALHKVEQYFHHFANAYEII
CRAQDREFFGLRDYYSLIKMLFALVKRSKSKPRPRDIAEVVLRNFSGKDDINALEIFTSQ
LPERGEVNAHDVSRIELIQQNIYSSSEDGDCRYLLVLTENYAALQILQQTFFTARQQPEI
IFGSSFPKDQEYTQICRNINRVKVCMETGQMVVLLNLQNLYESLYDALNQYYVYLAGQKY
VDLGLGTHRVKCRVHPKFRLIVIEEKDVVYKHFPIPLINRLEKHYLDISTVLDKEQREKV
KELKKWVRDFVAVDTREHLMNQQNYSPSDVFVGYHSDTCASVVLQITERLKATCPPSQLM
ARVKAEAQLALLNCATPDSVIRLCNSGGLFRTNSLAYVYFKQQQHSSFADFLRAHICSGS
ECQTVFTEVTTFSRLLTSADSAYLEKEVQGKAQRPQILFLQQFDTEYSFLKGIRDFLEAT
SGNKVLIIQADFEDGSQNAQLVASAKYTVVNEINKANLGECSVFVYFIMKLTRVEGGTSY
VGFHGGLWQSVHIDDLRRSKDMISDMSVLQNLTISQMLSEDLGKAKDADPPVSGEEEEER
EGEDEASVPAAEHCEEANDTDSLESNIIHNKMDVLGARKGEVLDIVVLLRSCVQSAVGML
RDQNENLSRSRKRIEILLSLLSKENGLKASFLKTTRARLSSLLKKQEENSFQPRNWVLRA
ASNLGALQEAGTFRHTLWKRVQKAITEFLALLIAVIDRNGNLELLARPAPEWVTNLWMFI
FSDTKLLTVPSGGGKNSSQTEIILVQNSMMVSADAGNKMPFSWRIKEYLDEMWLKAQYIQ
NTEDQAENFMDIFQKTALGEFLSALTEGERLELFQCYLTDFIVLTIGVSSTEELQCLQLA
FLSCIEEWKAASPRRQEAVPCLPWVHLGYNQFKSRLQNFSRILAVHPRAVDSLLNLKEDG
MSHPNMVLDILAAIVCAEELESQMETAQPEMWLQKVKNLQMPIEFICKDKFLQRSDTWCQ
RLLQQLKTCWNRVFCMSLFIEHVLLGTSALMPEVEKLVKNHTLLLAKRFDEGSDMKTHPT
FVAVIKVLCKCKEEISSRLYRHELKPCSICHGELKDPVELCCSHAFCEKCIRSWLIPAHM
HCPLCRVAVEDDNLTVNKELSAAIAKNALFRQRCNNFFIDVVTTMCFKDNEPPDTAVIQE
LLNLLFVYRDFLEDSDHPAAYTKLLSPFDEEVDETPVIRSVMLKLLLKYSFSEVKNDVQD
YLSRVECSHILDKRDKKELYLLFVNCLEDSMCDKFEGSLGCECVDSLLGDRGFPENYLPQ
SNQEAPQESSVEYLQAVAKVRWYLTKAAELLYDLYELPEQDQVEEKKHYLENVKVFCDLS
QNDWHRVYLVRKIAHLYGMEFAQKLVMEARFNWVFPVEILQQVQSSQSNHIDRYLACGKG
YKVLRDAVGKVMIECKPEDLLEAEKASGSTPAVRSVHLLLAIFREVTALYGFSDSSFHPK
QQQTYAVTEFIQNSEVLSSPDMQNFAMSLVMNTLPSVLSVDPQSFSNNGALIEMAVHTMA
VLLCGQNPILQPLRNLAFSPHIMQHSFLPTMPEDLLAQARTWKGLEGLHMYLCPNGHPCT
VGECGRPCQVGRCIECGLEVGGLNHNKLPGFTEFRSTEDRTQTGHILGDAQHRRGQAVSD
RSMTPAVFVLIRLLTHLTMLLGATKDPQSLRNIIKPQVRNSVTFLQQHIQEDLAQLTRIL
GKSVDETINILHLVLSSLLKDQHPEQGPVQFDGVLSTKEKRNKWEEIIASTVVVPELEDL
DKKLLKLNEQIHEDERISSNPVVKIVYGDPVTFLSQLPKDSHIHHSKMWSSRKRISVENL
GHVVQQMNAKDTVPLLWKFLQKETELRLVKYLPEILALQRDLVRLFQNISDAKRCTIREF
LSEPVSDVMWVLLERRVDVFLSVWNKLRSSLDTNGEFKLPKGYCDADLTLDSKLEVLLPR
RQGLGLCSTALVSYLISLQNDFIHSVNKHIKEDDRYLISPSEVADLHLISYEVERDLIPL
ILSNCQYSMEKGGETLQHVDLERIQQQVISKFLQGKPLITLTGIPTLVYRHDWNYEELFN
DIKNKQRLHQSALPSSVMNAISGELQSYSDVCDALSVTEIALEFLAMAGENTEMLLTDYI
ENVLQMGDQTNSHVLQALRRCHLKHIIALWHLLSTHKSEQLLRLRRDPFEDISTEYKADL
SPEMAKLLNTYLVHSRLETFLQELHKMIILKLKRVRSADEFRPTWGVKESLIPLLDEKDS
ELAEELQDMFPDEIHLSHVAATWKAAAIFKTTRASR
Download sequence
Identical sequences G1N3C4
ENSMGAP00000006202 ENSMGAP00000006202

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]