SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000006490 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000006490
Domain Number 1 Region: 213-484
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.91e-80
Family Protein kinases, catalytic subunit 0.000000168
Further Details:      
 
Domain Number 2 Region: 125-257
Classification Level Classification E-value
Superfamily SH2 domain 3.77e-36
Family SH2 domain 0.00019
Further Details:      
 
Domain Number 3 Region: 62-147
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000000604
Family SH3-domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000006490   Gene: ENSMGAG00000006462   Transcript: ENSMGAT00000007243
Sequence length 498
Comment pep:novel chromosome:UMD2:22:9893679:9900002:-1 gene:ENSMGAG00000006462 transcript:ENSMGAT00000007243 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QTLHPPGMEQFVRKRLTFLTSFWNKLWPRSGPDSCSLGYFGSDSVSLHSEPSCVSFIPKS
SLCIALYAFTARSADELTVNAGDKLRVLREEGDYVLARRLLGEPATGYVPAAYVANLSQG
TSAHRPWYFSKISRSEAEQLLLSPPNQHGSFLVRDSESSRGEYSLSVRNHTKVSHFRICK
SPSGSLYIQRGHPFPDMEELLAFYTENWKVIQSPLLQPCSPTTPPERDGWERPRWEFTLR
RKLGEGYFGEVWEGLWRNTVPVAIKIIKADMKAEDFTKEIQNLKRLRHEKLIQLHAVCSL
DEPVYIITELMRKGNLHSYLNSPEGKSLGTSHLLNIACQVADGMRYLEEKHIVHRDLAAR
NILVGEELTCKIADFGLARLLKDDIYSTSSSTKIPVKWTAPEAANYRTYSLKSDVWSYGI
LLYEVFTYGQIPYEGMTNQETIRQITRGYRLPRPSSCPPEIYSIMLECWSGNTEERPTFL
ALREKLGFIYRRLLNTLS
Download sequence
Identical sequences G1N3Z8
ENSMGAP00000006490 ENSMGAP00000006490

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]