SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000006674 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000006674
Domain Number 1 Region: 856-914
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000183
Family TSP-1 type 1 repeat 0.0039
Further Details:      
 
Domain Number 2 Region: 49-106
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000824
Family TSP-1 type 1 repeat 0.0012
Further Details:      
 
Domain Number 3 Region: 626-692
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000196
Family TSP-1 type 1 repeat 0.0031
Further Details:      
 
Domain Number 4 Region: 796-861
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000314
Family TSP-1 type 1 repeat 0.0029
Further Details:      
 
Domain Number 5 Region: 747-801
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000392
Family TSP-1 type 1 repeat 0.008
Further Details:      
 
Domain Number 6 Region: 571-629
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000114
Family TSP-1 type 1 repeat 0.0094
Further Details:      
 
Domain Number 7 Region: 694-744
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000119
Family TSP-1 type 1 repeat 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000006674   Gene: ENSMGAG00000006630   Transcript: ENSMGAT00000007429
Sequence length 958
Comment pep:novel chromosome:UMD2:19:7177263:7195937:1 gene:ENSMGAG00000006630 transcript:ENSMGAT00000007429 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKRKNNHCVWSWLRAALALLIVGNMAFVIAQDLPQTSNSLEEGADVTAYWWGEWTKWTAC
TRSCGGGVKSQERHCLRQRRKSVSGLANKTCTGTSKRYQLCKVQECPANGRSFREEQCSS
FNSHVYNGRTYQWKPLYPDDYVHISSKPCDLHCTTVDGQRQLMVQARDGTSCKYTDFRGV
CVSGKCEPIGCDGILFSTHTLDKCGVCQGDGSSCTHVTGSYRKGNAHLGYSLVTHIPAGA
RDIQIVERKKSADVLAVADEAGYYFFNGNYKVDSPKNFNIAGTVFKYRRPMDVYETGIEY
IVAQGPTNQGLNIMVWNQNGKNPSITFEYTLLRKPHSNLQPIYYTFSESDSEESREFDGD
VPLGFIQHNATYFGKISRERIDLENQVFGRQDTEEDLNLSKGQETNEVYERAETIDCEPK
LKGKQPKDSNVTRSTYQTDHDDRDFDARFTSREFLSENAITDKLLDKSSDSKELVLNMTM
NSIFAQGDPINSVGSHIDSLYVDYEDTDGIVTYTINGTYMELSNGKAINSSAETPFSNAT
VTMTSSQGNRTHKARNRLKLLRKGQGVSAADMYRWKLSSHEPCSSTCTTGVMSTYAMCVR
YDGIEVDDTYCDAMTRPEPVHEFCAGRECQPRWETSSWSECSRTCGEGYQFRIVRCWKMI
SPGFDSSVYSDLCESADITRPDERKVCKNPACGPQWEMSEWSECSARCGERSVVTRDIRC
SEEEKLCDASARPLAEKNCTGPPCDRQWTVSDWGPCSGGCGQGRMIRHVYCKTSDGRVVP
ESQCNLETKPLAIHPCGDKNCPSHWLAQDWERCNTTCGRGVKKRIVLCLEIVNGKIKTHN
PTDCDVAKKPVEETTCFERPCFKWYTTPWSECTKTCGIGVRMRDVKCYQGKDIVRGCDPL
VKPVGKQTCDLQPCPTEPPDDSCQDQAGTNCALAIKVNLCSHWYYSKACCRSCRTPHS
Download sequence
Identical sequences G1N4C9
ENSMGAP00000006674 ENSMGAP00000006674

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]