SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000006940 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000006940
Domain Number 1 Region: 75-209
Classification Level Classification E-value
Superfamily BAG domain 1.23e-51
Family BAG domain 0.00000416
Further Details:      
 
Domain Number 2 Region: 7-91
Classification Level Classification E-value
Superfamily Ubiquitin-like 3.68e-16
Family Ubiquitin-related 0.0000856
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000006940   Gene: ENSMGAG00000006862   Transcript: ENSMGAT00000007704
Sequence length 209
Comment pep:novel chromosome:UMD2:3:34841887:34852390:-1 gene:ENSMGAG00000006862 transcript:ENSMGAT00000007704 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVPGAPVTVTVTYSNEKHNIQVASQQEDSEPTLQDMAVLIEQVTGVPVSFQKLIYKGKS
LKELEQPLSALGVKNGCKVMLIGKRNSPEEEAELKKLKDLEKSVEQIANKLEEINKEFTS
IQKGFLAKDLQTEALKQLDKRIKGTAEQFMKILEQVDAINLPENFNDCRLKKKGLVKRVQ
AFLAQCDTIEGNIGQEMDKLQSKNLALAE
Download sequence
Identical sequences G1N4Y2
ENSMGAP00000006940 XP_003204914.1.16129 ENSMGAP00000006940

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]