SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000007171 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000007171
Domain Number 1 Region: 1167-1362
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 3.73e-57
Family BCR-homology GTPase activation domain (BH-domain) 0.0000232
Further Details:      
 
Domain Number 2 Region: 957-1080
Classification Level Classification E-value
Superfamily PH domain-like 3.22e-32
Family Pleckstrin-homology domain (PH domain) 0.00000113
Further Details:      
 
Domain Number 3 Region: 41-165
Classification Level Classification E-value
Superfamily PDZ domain-like 1.84e-19
Family PDZ domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000007171   Gene: ENSMGAG00000007092   Transcript: ENSMGAT00000007938
Sequence length 1994
Comment pep:novel chromosome:UMD2:6:16988435:17135269:1 gene:ENSMGAG00000007092 transcript:ENSMGAT00000007938 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLCVVETFSSVLYTAVLNNFLREANASKNKDGKEQSEAISPSEEEEAFSWPGPKTVVLRR
TSQGFGFTLRHFIVYPPESAVQFSFKDEENGNRQGKQRNRLEPMDTIFVKQVKEGGPAFE
AGLCTGDRIIKVNGESVIGKTYSQVIALIQNSDSMLELSVMPKDEDILQLLQFTKDVTAL
AYSQDAYLKGNEAYSGNAHNIPEPPPICYPRLTPTTSVVAQAGDKLSSSDFSLGKQQVSR
PVRALTQPERAYRMEIQVPPSPTDIAKSNTAVCVCNETVRTVIVPSEKAVDLPSCRNNHA
GPSHRTEEIRYGLKDQTTLKARTTSPSSSVSTAIVLPQTPLTRPGDPNGTVIKASNYVVC
PEGIPSTRPSVQATDSPSISTNHYSSPSSHQHIDWKNYKTYKEYVDNRRMHMYGSRTIQE
RLDSLRAASQNTTDYNQVVPNRTASQVRRRSTSHDRVPQSAQIRQRSVSQERLEDPVLMK
EWPRSASQDTLTSPSLSARNHRARSWDYLSKQGEMLENFHSENLIADTNGDRRKTYKWTG
FSEQDDRRGIYDRPRQHAFHMSLRGQNFPLGPSGYISDGRRVGSRASLPGSHFQKVSPDI
RMLQPSRELQTPGGISKPTAVSQERTSLITARSSKSSSLKNSSYAAKPSFPLNQSLDVVA
SKDQRTVNHLHQSGLLNQQSRTRGEAAPDHRTEMGKTMQPSSLSPTSAKLVQQTSESSTT
SDNTGVSIRKRSHDFEKENAHEPEILQTDVQGNDKDAVVMRDKSPSGHQTPQPLRHQSYI
LAVNDQEAASDTTCWLPNDARREVHIKRIEERKASGSTPPGDSLASIPFIDEPTSPSIDH
DIAHIPASAVISASASQAPAITTVPPSPTSPIPLIRRQLSHDHESIRPSILDSQPATKPE
RSKSYDEGLDDYRDEEKSSIKHVSSLKGIKVTDSQKSSEDSGSRKDSSSEVFGDASKEGW
LHFRQLVTDKGKRVGGSIRPWKQLYVVLRGHSLYLYKDKKEQMTPSEEEQPISINACLID
ISYCETKRKNVFRLTTSDCEYLFQAEDRDNMLAWIKAIQENSNLNDEDTGVTSRDLISRR
IKEYSTMMSKTEPSPKTPRQSLSIRQTLLGTKADQRTQSPHSPKDESERKLLTKDETSPP
KDKGTWRKGIPSIMRKTFEKKPSAVGTFGVRLDDCPPAHTNKYIPLIVDICCKLVEERGL
EYTGIYRVPGNNAAISSMQEELNKGMTDIDVHDDKWRDLNVISSLLKSFFRKLPEPLFTN
DKYADFIDANRKEDPVERLKTLKRLIHDLPEHHYETLKFLSAHLKTVAENSEKNKMEPRN
LAIVFGPTLVRTSDDNMTHMVTHMPDQYKIVETLIQKHDWFFTEDDAEEPLTAVQEENTV
ESQPVPNIDHLLTNIGRTGVSPGDVSDSATSDSTKSKGSWGSGKDQYSKELLVSSIFAAA
SRKRKKTKEKPQPSSSEDELDNVFAKKELAEQSRGDAAKEDTAKGEYEKERDAGRKQRMF
VLKEKDSSSKKDVNVVKDEKKSLRKESLLSEEPSLPYHEKRTKSQSLSCQQTLQKHNPKM
PISQSSSQVEETVSDSGTMLSTSSQASQHRYSCKKITSPEIKHSEFLAADVSSITSDYST
TSSSIYITGLDASMLSPEVQSVTESKGEDADDERSELISEGRPMETDSESDFPVFATSSA
AERLSKGKVSEVFKSSRRNSEESEVSCTEGSSTPKLESRRLFSSHKLIECDTLSRRKSAR
HKTDSEGSGDAKSEKDLPTVTKMFDMMKKGRSTSSLATSARSETDKQEPTWRLKITDRLK
LRLKSSADDMFGVGNQKANSAETVKRKNIRRRHTLGGQRDFDEISVLNVWKVQEPSQSRE
RESELSAVNRLKPKCPAQDLSISDWLARERLRTSTTDLNTGETGKPRLENTSLADASKVD
LPLSAEMQADEGSSSSSLTSISRTPPSGPFQPPDQVNGESYQNMNKNNFSPAVDAHPHKL
SGTQVVRSRFYQYL
Download sequence
Identical sequences G1N5F0
ENSMGAP00000007171 ENSMGAP00000007171

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]