SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000007438 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000007438
Domain Number 1 Region: 94-212
Classification Level Classification E-value
Superfamily PX domain 6.87e-16
Family PX domain 0.0024
Further Details:      
 
Domain Number 2 Region: 291-346
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.00000128
Family SAM (sterile alpha motif) domain 0.0064
Further Details:      
 
Domain Number 3 Region: 833-864
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000075
Family Retrovirus zinc finger-like domains 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000007438   Gene: ENSMGAG00000007316   Transcript: ENSMGAT00000008212
Sequence length 888
Comment pep:novel chromosome:UMD2:13:17894109:17935181:-1 gene:ENSMGAG00000007316 transcript:ENSMGAT00000008212 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASNHPAFSFHQKQVLRQELTQIQNIMASTSKNPSSSALNSMATYPGCHKVTARSETPIN
SVSNSLENVLHTSTHSIEESLPKRPSGKHSKVSVEKVELKGLAHKKNERNVEYSFEVLWS
DSSVTLVTKSSVEVTEFISKLSQLYPEENLEKFIPCLAGPDSFYLERNHMDLESDLRYLA
PLPSHVVKNDHVRKFFSTSSPSQQLQSSNPGNPSLYKVGTTLGTSGRPICGVAGIQSSQN
HVQHSAAAPVALPHCSHAGGTGSSLAYRNQMDAASPMLMSSSPQTPQTQEQNGILDWLRK
LRLHKYYPVFKQLTMEKKFLSLTEEDLNKFESLTMGAKKKLKTQLELEKEKSEKRCLNPT
TPSSVTSSGVARVPPTTHVGPLQSIRGNHAAELRVDVDQPAHPLPREGSSSEYSSSSSSP
MGIQTREESSDSAEENERRLEIHLDGSEKEKPVMLLNHFTSSSARPTAQVLPVQNDAGSN
PSGHHTLPMQMMSAASTHITPIRMLNSVHKSERGNADMKLLSSSMHSLLSLEERNKVSPG
PRGSIKMEKSFGNTVVDVMSAPSPHQPLQVLSGAAENSSPTSTINFGPRTKVVHASTLDR
VMKTAQQPGLIVETSTAATVTSSTVFHVARPPIKLLVSSSVPTDPAIAGQTSCSSNMQIT
VSPAIINPRTALYTANTKVAFSAMSSVPVAPMQGSFCANSNAASSSSHPSTSFATMANLP
SCPAPSSSPTLSSVAENNFWMTVSYANYFQHPFSGPSMFTFPFLPFNPLCSNGYINTQQY
NSSTTFPVVHTAYNSGIAPDSVMTGQSTFAVPPMQNFMAGTAGVYQAQGMMGNGNGSSHK
KNGNLSCYNCGASGHRAQDCKQPPMDFNRQGTFRLKYAPPSESLDSTD
Download sequence
Identical sequences G1N5Z8
ENSMGAP00000007438 ENSMGAP00000007438

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]