SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000008865 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000008865
Domain Number 1 Region: 60-207
Classification Level Classification E-value
Superfamily EF-hand 5.98e-41
Family Calmodulin-like 0.00038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000008865   Gene: ENSMGAG00000008625   Transcript: ENSMGAT00000009673
Sequence length 209
Comment pep:novel chromosome:UMD2:17:9651156:9659665:-1 gene:ENSMGAG00000008625 transcript:ENSMGAT00000009673 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IRHEEKTCYKAVQTSEEGPSEYQGPLMVLAQNCAVMHNLLGPACIFLRKGFAENRQPDRE
LRPEEIEELREAFKEFDKDKDGFINCRDLGNCMRTMGYMPTEMELIELSQQINMNLGGHV
DFEDFVELMGPKLLAETADMIGVKELRDAFREFDTNGDGEISTSELREAMKKLLGQQVGH
RDIEEIIRDVDLNGDGRVDFEEFVRMMSR
Download sequence
Identical sequences A0A226NAJ0 G1N918
ENSMGAP00000008865 ENSMGAP00000008865

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]