SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000009106 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000009106
Domain Number 1 Region: 51-509
Classification Level Classification E-value
Superfamily Sema domain 2.49e-112
Family Sema domain 0.000000792
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000009106   Gene: ENSMGAG00000008867   Transcript: ENSMGAT00000009920
Sequence length 1027
Comment pep:novel chromosome:UMD2:Z:76904424:76969012:1 gene:ENSMGAG00000008867 transcript:ENSMGAT00000009920 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRSEALLLYFTLLHFAGAGFPEDSEPISISHGNYTRQYPVFVGHKPGRNTTQRHRLDIQL
VTVMNRTLYIAARDHIYTVDMDTSHTEEIYFIKKLTWKSRQADVDTCRMKGKHKDECHNF
IKVLLKRNEDTLFICGTNAFNPSCRNYKVDTLEFLGDEFSGMARCPYDAKHANVALFAEG
KLYSATVTDFLAIDAVIYRSLGESPTLRTVKHDSKWLKEPYFVQAVDYGNYIYFFFREIA
VEYNSMGKVVFPRVAQVCKNDMGGSQRVLEKQWTSFLKARLNCSVPGDSHFYFNILQAVT
DVIHFNGRDVVLATFSTPYNSISMSSCCGIDTQESQSCLSRAVTQQRGTSKVSWRSIGDD
SDPSITSETCIEDSSLHIYIVSLEILASVISFINTIPLMSVALPTSAFGQPNWCKKVLKY
RLTKIAVDSAAGPFKNYTVVFLGSEKGIILKFLARTGNSGFLNDSLFLEEMNIYNPEKCV
SDSFYSKMLLHMQIHSGGITFYLTFNTDCIQSRYFSLTEKAGKKNGSSKTALPFTGLVEI
LLYLQSVFLFTYQENVSLGHVFPLDCCTHGASTCLLGNRQPCRPSVISSDSWARQGYDAR
GRMLDWKDPLGSSENTDPYVAVSSHNHQDKKGKALETTSCEHRVSLPVILIVIAVILAFV
MGAVFSGIIVYCICDHRRRDVAVVQRKEKELTHSRRGSMSSVTKLSGLFGDAQSKEPKPE
AILTPLMHNGKLATPGSTTKMLIKADQHHLDLAALPTPESTPTLQQKRKPSRGSREWERN
QNLINACTKDIPPMASPVIPTDLPLRASPSHIPSVMVLPIAQQGYQHEYVDQPKISDGAQ
MSVEDQNATLEYKTIKDHLSSKSPSRGINLVENLDSMPPKVPQREASLGPPSTSLSQSGL
SKRLDMHSSAYNVDYKRNYPTNSLTRSHQASTLKRNNTNSSNSSHLSRNQSFGRGDNPPP
APQRVDSIQVHAAQAQAMIVSRQPSLSTYNSLTRSGLKRTPSLKPDVPPKPSFAPLSTSM
KPNDACT
Download sequence
Identical sequences G1N9L1
ENSMGAP00000009106 ENSMGAP00000009106

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]