SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000010332 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000010332
Domain Number 1 Region: 2-197
Classification Level Classification E-value
Superfamily EF-hand 3.74e-23
Family Calmodulin-like 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000010332   Gene: ENSMGAG00000009977   Transcript: ENSMGAT00000011185
Sequence length 206
Comment pep:novel chromosome:UMD2:17:11660482:11843519:1 gene:ENSMGAG00000009977 transcript:ENSMGAT00000011185 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PELRALGEQHSFTSEQIEQLHRRFKQLSHNRKTIRKEDFDTIPDLEFNPIRARIVHAFFD
KRNLRKAPAGLAEEINFEDFLTIMSYFRPIEMDMDEERLESFRKEKLKFLFHMYDADYDG
IITLQEYKNVLDELMSGNPHLEKESLRAIAEGAMLEAASACMARTGPDEVYEGITFEDFL
KVWKGIDIETKMHVRFLTMEAIAHCY
Download sequence
Identical sequences G1NC86
ENSMGAP00000010332 ENSMGAP00000010332

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]