SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000010519 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000010519
Domain Number 1 Region: 677-809
Classification Level Classification E-value
Superfamily PH domain-like 7.71e-31
Family Pleckstrin-homology domain (PH domain) 0.0075
Further Details:      
 
Domain Number 2 Region: 1226-1359
Classification Level Classification E-value
Superfamily Second domain of FERM 1.1e-18
Family Second domain of FERM 0.005
Further Details:      
 
Domain Number 3 Region: 819-933
Classification Level Classification E-value
Superfamily PH domain-like 3.94e-18
Family Pleckstrin-homology domain (PH domain) 0.018
Further Details:      
 
Weak hits

Sequence:  ENSMGAP00000010519
Domain Number - Region: 1128-1207
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000241
Family First domain of FERM 0.074
Further Details:      
 
Domain Number - Region: 27-120,713-733
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.000262
Family BAR domain 0.071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000010519   Gene: ENSMGAG00000010134   Transcript: ENSMGAT00000011378
Sequence length 1502
Comment pep:novel chromosome:UMD2:2:25427327:25474773:1 gene:ENSMGAG00000010134 transcript:ENSMGAT00000011378 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADLSEPEGTVNWKERCLTLESQLMKFRLQASKIRELLAEKMQQLERQVIDADRQAERAF
QQVQVMEEKLKAANVQTSESENRLYKRCQDLETLVQDKNDVIQKLEQQLEEQKQIRLQEA
KIIEEKAAKIKEWVTVKLHELEVENQNLRLINQKQIKEMKTVQSKLQEATGKKSVTSTQK
PGECQRLSGLTFGCFSNRARSPQPSPKFEEISKSSSKELDYTESKNTLEKDTLETTSAGS
AHESNKGQKSLQQSSSGSEQNKNVRTSRSSKDVDSDMSKNSCTTGSDWSSDEDGGDNKGL
KSRCASTLSSHTSEENARYSRVGSEMYLTASDDSSSLFEEESLGIQRTQHKKLYSWQQGS
QRKGQNNLGGRCNSDFTSKKKDPDSSSDELNKKFQSQRLDYSSSSSEANTPSPILTPALA
HKHPTRATSAGSQGTTPSDSPSNLPPPKLRTPNVFSMNSSLAKKYLSQPQLSSDRMFGRN
RNAISMIRPWRPQETDIDQVDGEDTVILEKMEVGCDEGVFTYDCTEAQDAEAQEPCDMTK
KVASNKPPTPPLHRFPSWESRIYAVAKSGLRMSEAFTTESLNKSAASLTSYSISGLYTSL
IYKNMTTPVYTTLKGKATQISNSPFIDESSGSEEEESSRSSSRTSESDSRCRSGPGSPRA
MKRGVSLSSVTSDSDYAIPPDAYSVDTDYSEPEQKLPKTSSSSSDNGKNEPLEKSGYLLK
MSGKVKTWKRRWFVLKGGELLYYKSPSDVIRKPQGQIELNASSHIERGDGKQTIQLTTEK
RTYYLTADSPNILEEWIKVLQNVLKIQAASPLFIQPEIKPTMKGLLTKVKHGYSKRVWCT
LVGKTLYYFRNQEDKFPLGQIKLFEAKVEEVDRSCDSDEDYEASGRSLLSTHYTVVIHPK
DQGPTYLLIGSKHEKDTWLYHLTVAAGSTSVNVGSEFEQLICKLLNVDGDTTSQIWRHPT
LCHSKEGITCPLTTLPSEALQTEAIKLFKTCQLFINAAVDSPAIDYHVSLAQSALQICLT
HPELQNEICCQLIKQTRRRHPQNQTGPIQGLQLLALCVGLFLPQHPFLWLLKLHLKKNAD
SSHRTEFGKYAIYCQRCVERTQQNGDREARPSRMEILSTLLRNPYHHSLPFSIPVHFMNG
IYQVVGFDASTTVDEFLNTLNQDTGMRKPAQSGFALFSDDPSGKDIEHCLQGNIKICDII
SKWEQASKEQHPGKCEGTRTVRLTYKNRLYFSVQAHGETDREKLLLVYQTNDQIVNGLFP
VNKELAMELSALLAQVEIGDFERPFSTPAGQVTSQSKSNQTLKQVLERFYPKRYRFGCSE
EQLRQLCQRLSTRWMALRGHSAADCVRIYLTIARKWSFFGAKLFAAKPLATSSLEKSFIW
FAVHEDGISILDYSTMRLTVTYTYKSLMTFGGYQDDFMLVVNDAQTKDKATEKLLFAMTK
PKILEITLLIASYINNFHQQKGAAHHLSAPALLTPQSGQKLKEMGSQPLLTNNRPTKCPT
LL
Download sequence
Identical sequences G1NCN0
ENSMGAP00000010519 ENSMGAP00000010519

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]