SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000011234 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000011234
Domain Number 1 Region: 443-688
Classification Level Classification E-value
Superfamily vWA-like 3.39e-69
Family Trunk domain of Sec23/24 0.0000823
Further Details:      
 
Domain Number 2 Region: 197-460
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 9.68e-37
Family beta-sandwich domain of Sec23/24 0.0044
Further Details:      
 
Domain Number 3 Region: 691-785
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 6.41e-36
Family beta-sandwich domain of Sec23/24 0.0016
Further Details:      
 
Domain Number 4 Region: 893-1034
Classification Level Classification E-value
Superfamily C-terminal, gelsolin-like domain of Sec23/24 1.49e-33
Family C-terminal, gelsolin-like domain of Sec23/24 0.0017
Further Details:      
 
Domain Number 5 Region: 787-892
Classification Level Classification E-value
Superfamily Helical domain of Sec23/24 3.4e-29
Family Helical domain of Sec23/24 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000011234   Gene: ENSMGAG00000010783   Transcript: ENSMGAT00000012104
Sequence length 1038
Comment pep:novel chromosome:UMD2:4:36985641:37033041:1 gene:ENSMGAG00000010783 transcript:ENSMGAT00000012104 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSQQGYVTAPPYSQSQPRVGGFSAGFGPPNSSLHYGHYGDPNSSHAAAPQPGMSKSTVTL
GSSAPLGPLPPGTHQVSQNNFQSGPSAAGQQPHRFQSPLPPNNTGPSYPPGSHQSQPASP
NTVSTSCTTLANQLNSMQINSYGPGAIQSSHTSSGHPASFQGPQQLPLTQHQMTLQPGPQ
IPPPANNFSGLCAQSSLPSMSRQDGMPGSGLPNPNLQQLPGQTPGPGYHPQQANYGLQMA
GSQLSYPGAFPGGPAQLSGPPQKKLDPDSIPSPIQVIENDKASRGGQMYATNTRGQVPPL
VTTDCLIQDQGHASPRYIRCTTYCFPSSSDMAKQARIPLAAVIQPFAIVPQNETPLYVVN
HGETGPIRCNRCKAYMCPFMQFIEGGRRYQCGFCNCINEVPPFFFQHLDHIGRRVDHYER
PELSLGSYEYVATLDYCRNNKPPNPPAYIFMIDVSYRNINSGLVKLICDELKTLLDKLPR
EEEEESSAIRVGFVTYNKVLHFFNVKSNLAQPQMMVVSDVGEVFVPLLDGFLVNFQESRS
VVHNLLDQIPEMFADTNESETIFAPVIQAGMEALKAAECAGKLFIFHSSLPTAEAPGKLR
NRDDKKLLSTDKEKTLFQPQVNSYESLARDCVANGCCVNLFLFPNQYVDIASLGLVTMYT
GGTLYKYNNFQLNSDSPQFLTDLRRDIEKKTGFDAIMRVRTSTGFRATDFFGAMYMNNTT
DVEMAAVDCDKAVTVEFKHDDKLNEDSGALIQCAVLYTSVSGQRRLRIHNIGLNCSTQLA
DVYKTCETDALINFFAKSAFKAILSQPLKVVREILVSQTAHMLACYRKNCASPSTASQLI
LPDAMKVLPVYMNCLLKSTVLTGRPEIPTDERAYHRQLVMSMGVADTQLFFYPQLLPIHN
LDLKSDTVPAAVRCSEERLSEGGAFILANGLSMFLWLGVSTPPELIQGLFNVPSFAHIST
EATLLPDLANPYSKKIKSIVEHIQNQKPYTMKLMIVKQREQPEMLFRQFLVEDKSIHGGA
SYVDFLCCVHKEICQLLN
Download sequence
Identical sequences G1NE97
ENSMGAP00000011234 ENSMGAP00000011234 XP_003205768.1.16129 XP_010708249.1.16129 XP_010708250.1.16129 XP_019470288.1.16129

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]