SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000011575 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000011575
Domain Number 1 Region: 1188-1252
Classification Level Classification E-value
Superfamily TB module/8-cys domain 5.1e-21
Family TB module/8-cys domain 0.0000172
Further Details:      
 
Domain Number 2 Region: 511-578
Classification Level Classification E-value
Superfamily TB module/8-cys domain 1.7e-19
Family TB module/8-cys domain 0.00044
Further Details:      
 
Domain Number 3 Region: 1362-1421
Classification Level Classification E-value
Superfamily TB module/8-cys domain 5.49e-17
Family TB module/8-cys domain 0.0017
Further Details:      
 
Domain Number 4 Region: 969-1091
Classification Level Classification E-value
Superfamily Growth factor receptor domain 2.04e-16
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 5 Region: 387-455
Classification Level Classification E-value
Superfamily TB module/8-cys domain 0.000000000000549
Family TB module/8-cys domain 0.0036
Further Details:      
 
Domain Number 6 Region: 712-837
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000612
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number 7 Region: 804-966
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000361
Family Growth factor receptor domain 0.018
Further Details:      
 
Domain Number 8 Region: 454-501
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000363
Family EGF-type module 0.0081
Further Details:      
 
Domain Number 9 Region: 1086-1139
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000883
Family EGF-type module 0.011
Further Details:      
 
Domain Number 10 Region: 1464-1550
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000133
Family Growth factor receptor domain 0.015
Further Details:      
 
Domain Number 11 Region: 1304-1349
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000116
Family EGF-type module 0.0057
Further Details:      
 
Domain Number 12 Region: 237-269
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000121
Family EGF-type module 0.021
Further Details:      
 
Domain Number 13 Region: 1264-1313
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000335
Family EGF-type module 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000011575   Gene: ENSMGAG00000011074   Transcript: ENSMGAT00000012453
Sequence length 1559
Comment pep:novel chromosome:UMD2:2:31582403:31797010:-1 gene:ENSMGAG00000011074 transcript:ENSMGAT00000012453 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VNVCGGQCCHGWSKATGSQRCIKPNCAPPCQNGGMCLRPQLCVCKPGTKGNSCEDTVMQD
TSSTGGRSPVVPPWPIPQQAAQQAFSQKVQVPSKAGPMTQMAFTIKQKPPVGLPQQMQPQ
MIPLSSQTLMMNLHHGQTQEYVIKPKYYPVKKVISGEQSTEGSLPLRLGQDQLASSFQLG
NHTGRIKVVFTPSICKVTCTKGNCQNNCEKGNTTTLISENGHAADTLTATNFRVVICHLP
CMNGGQCSSRDKCQCPPNYTGKLCQIPVQNGNTPKLYHHPQQMNKAVGSQIIHSTHTLPL
TMSGQQGVKVKFPPNIVNIHVKHPPEASVQIHQVSRIDSASTGQKSKVPQPGHPQVSYQG
LPYQKTQKGHATYTNQQPIPHVFPVSVKTQLGRCFQETIGTQCGKALPGLSKQEDCCGTV
GTSWGFNKCQKCPKKPSYHGYGPMTECPQGYKRINATFCQDINECQLQGVCPNGECLNTM
GSYRCTCKMGFVPDPTLSRCIADSPMVAEEKGPCYRFVSAGKQCMHPLSVQLSKQLCCCS
VGKAWGPNCEKCPLPGTAAFKEICPGGMGYTVSGPHRNKLYHHPAVRVQPPVIGKTPITQ
PVAKGTSPPPLPAKEEPVEALTFSQKSEPDMAVQEVLVATAAPDQELVSLDQEKQILEPG
QPQLSPGISTINLHPQFPVVIEKTSPPLPVEVAPEVSTSSASQVIAPTQVTEINECTVNP
DICGAGHCVNLPVGYTCICYEGYRLNDQQTKCSDINECNQTPHLCSLGRCENTEGSFLCI
CQAGFMASEDGTDCVDFDECSRPHTCGEGFCINTVGSYRCEYCDSGYQMNRRGECEDIDE
CMTPTTCPDAQCINAPGSYQCIPCRVGFRGWNGQCHGMLSTITVSVSDYGSCLVMLFKSH
FLCCCWKLGIEFSWDHAIFTDINECQYGNLCANGHCENIEGSFRCICGQGFKLSASEDQC
EDIDECQHRSLCVNGRCRNTEGSFRCVCSEGYVLSATGDQCEDIDECLQDGDICLGGTCM
NTDGSYKCSCLDGFQQVANRGCEDINECERSDLCSPHGECLNTDGSYQCICEQGFSVSAD
SRMCEDIDECVNGTVCGSHGFCENMDGSYRCLCYQGYQDSQDGQGCTDVNECEMLSGVCG
EALCENVDGSFLCLCSDENQEYDPMTGQCRFRTTPELPIEPDQHEDGKKECYYNLNDANF
CDNVLASNVTKQECCCTLGAGWGDNCEIFPCPVFGTAEFTDLCPEGKGFIPSEESSYGLL
AENYKDADECQLFGQEICKNGFCLNTQPGYECYCKQGTYYDPVKLQCFDTDECQDPNSCI
DGQCINTEGSYNCFCTHPMVLDATEKRCIRPADSSEQTEETEVYQDLCWQHLSDDFVCSR
PLVGKQTTYTECCCLYGEAWGMQCALCPMKESEDYAQLCNIPVPGSRRPYGQDALVDFEE
HYTPETNPYFVEDRFLNSFEELQAEECGILNGCENGRCVRVQEGYTCDCFDGYHLDMAKM
TCVDVNECNELNNRMSLCKNAKCINTEGSYKCLCLPGYVPSDKPNYCTPLNSELDSELE
Download sequence
Identical sequences G1NF21
ENSMGAP00000011575 ENSMGAP00000011575

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]