SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000012014 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000012014
Domain Number 1 Region: 144-453
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.29e-94
Family Protein kinases, catalytic subunit 0.0000000000878
Further Details:      
 
Domain Number 2 Region: 7-112
Classification Level Classification E-value
Superfamily PH domain-like 3.41e-18
Family Pleckstrin-homology domain (PH domain) 0.00000555
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000012014   Gene: ENSMGAG00000011477   Transcript: ENSMGAT00000012900
Sequence length 481
Comment pep:novel chromosome:UMD2:2:35666322:35729345:1 gene:ENSMGAG00000011477 transcript:ENSMGAT00000012900 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FQTVYRYKDGILGRLGEYIKNWRPRYFLLKTDGSFIGYKEKPQDVDLPYPLNNFSVAKCQ
LMKTERPKPNTFIIRCLQWTTVIERTFHVDTPEEREEWTEAIQAVADRLQRQEEERMNCS
PTSQIDNIGEEEMDASTTHHKRKTMNDFDYLKLLGKGTFGKVILVREKASGKYYAMKILK
KEVIIAKDEVAHTLTESRVLKNTRHPFLTSLKYSFQTKDRLCFVMEYVNGGELFFHLSRE
RVFSEDRTRFYGAEIVSALDYLHSGKIVYRDLNTQLENLMLDKDGHIKITDFGLCKEGIT
DAATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHEKLFELI
LMEDIKFPRTLSADAKSLLSGLLIKDPNKRLGGGPDDAKEIMRHSFFAGVNWQDVYDKKL
VPPFKPQVTSETDTRYFDEEFTAQTITITPPEKYDEDGMDCMDNERRPHFPQFSYSASGR
E
Download sequence
Identical sequences G1NG32
ENSMGAP00000012014 ENSMGAP00000012014

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]