SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000012611 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000012611
Domain Number 1 Region: 972-1099
Classification Level Classification E-value
Superfamily PH domain-like 7.08e-22
Family Pleckstrin-homology domain (PH domain) 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000012611   Gene: ENSMGAG00000012007   Transcript: ENSMGAT00000013507
Sequence length 1116
Comment pep:novel chromosome:UMD2:6:47695701:47717884:-1 gene:ENSMGAG00000012007 transcript:ENSMGAT00000013507 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TTQKLLERTRARRENLQKKMAERPTVGARLAVQTKRVREPLLETGNQAPLPDEEVKPSTK
PSPSKRRCSNNIETQASTIENTQPVPSSSPSHRSPVMNSELRGTVCNKTSPAQPLEKGKT
STKSETPATLSVKTRMQKLAEQRRCWDSEVFSFPDPSECAHLSPLQSKDLSVSPPKRATN
DLASGTPIGRRGRLANLAATIGSWEDDLSHPSAKQNNAQEQPGTTCLSKLSTTSGASARI
NSSSVKQEAASCSQRLVEASINKPANSKIASQLNIISFSLLKDPNNLITQSSSCTVPAFK
ESEVLQQLTENRCSPQKTEKRTQTVQSTLSQSVQSKEETVKGTHVQPEPKDKPTTPGGSG
IKPFLERFGERCQENSARSPSTNTAGYRTPIVTPNTRTIQEKLLKQNENSSTATLALQLK
QERERELACIRGRFDRGNLWSAERSESSKRKLPEAKMDGPSQGSPKRSPRSDTTSGSAED
VPAGDRPVESPSVESSDAPKCEETDKSSSLMVTQPKSPVEAMPVSKLEQLAEKPDDEVCE
VEVKAGDEMNSSKVINEIFEILQEDGPDIEKLKKEMSMSLEGESDDDEQEESLNISSMSL
LTPLVESVGPEVFVSPSKSVGEDSSVSDVSQKSEKFQRTKVPRAESGDSMSSLSEDRSLP
YSVDAYRSQRFKETDRPSIKQVIVRKEDVASKLEMKKNGPCDQVNIKKKMQELNNEINMQ
QTVIYQASQALNCCFDEEHGKGSQEEAEAERLLLLATEKRTALLEELNKLKIEGPLIKRN
KAASTSSDFIPSRGSVSISEMRLPLKADFVCGTVQKPEAANYYYVIILRSGAENMVATPL
ASTASSLNGDALTFTTTFTMHDVSNDFEITIEVYSLVQRKEAPGTDKKKKANKSKVITPK
RLLTSITSKSTLLTPAMASPGGPNAVRTTNFILVGSHKLSLSSVGHAKFALDKVPVLSPL
EGHIYLKLKCQVDSSVEEKGFLTMFEDVSGFGAWHRRWCVLSGNCISYWTYPDDEKRKHP
LGRINLANCTNRQIEPVNREFCARPNTFELITVRPQREDDKETLVSQCRDTLCVTKNWLS
ADTKEERNLWMQKLNQVLVDLRMWQPDACYKPIGKL
Download sequence
Identical sequences G1NHF6
ENSMGAP00000012611 ENSMGAP00000012611

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]