SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000012809 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000012809
Domain Number 1 Region: 1-63
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0000000000000502
Family BAR domain 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000012809   Gene: ENSMGAG00000012192   Transcript: ENSMGAT00000013707
Sequence length 115
Comment pep:novel scaffold:UMD2:GL429654.1:3:5840:-1 gene:ENSMGAG00000012192 transcript:ENSMGAT00000013707 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AEEEFQKAQKVFEEFNTDLQEELPSLWSRRVGFYVNTFKNVSSLEAKFHKEIALLCHKLY
EVMTKLGDQHADKAFTIQGAPSDSGPLRIAKTPSPPEEVSPLPSPTASPNHMLAP
Download sequence
Identical sequences H9H1V1
ENSMGAP00000012809 ENSMGAP00000012809

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]