SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000013282 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000013282
Domain Number 1 Region: 4-143
Classification Level Classification E-value
Superfamily PX domain 5.36e-36
Family PX domain 0.0000011
Further Details:      
 
Domain Number 2 Region: 239-338
Classification Level Classification E-value
Superfamily CAD & PB1 domains 1.07e-23
Family PB1 domain 0.0000223
Further Details:      
 
Domain Number 3 Region: 169-232
Classification Level Classification E-value
Superfamily SH3-domain 7.48e-19
Family SH3-domain 0.00081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000013282   Gene: ENSMGAG00000012609   Transcript: ENSMGAT00000014185
Sequence length 350
Comment pep:novel chromosome:UMD2:1:49783473:49795406:1 gene:ENSMGAG00000012609 transcript:ENSMGAT00000014185 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLPRQLREKSDFDQLPDDVPVSANIADIEEKKGFTNYYMFVIEVKIKSGGRYLIFRRYR
EFYALHTKLEERYGGESKNSPFSCTLPVLPGKVYVGAKREIAENRIPILNIYMKNLLCLP
VWVLMDEEVRLFFYHSNFDSEQVPRRLRRLRPRTRRVKSISSQLPVLDRVATPRAEALFD
FSGTSKLELSFKKGDLIYLLSRVNKDWLEGTVNDATGIFPSAFVKIIKDLPQQEDIVNKI
RCYYYDETVSTIRDISVEEDLSSIPLFKDLMELIKQEFDQHDIVLNYRDLDGDLIRLLSD
QDVELMVSQSRKRSTEKHFFPWKLHITHKDDFSVYSTSPGIGDTQTVRTT
Download sequence
Identical sequences G1NJ08
ENSMGAP00000013282 ENSMGAP00000013282 XP_003202309.1.16129

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]