SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000013379 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000013379
Domain Number 1 Region: 1226-1291
Classification Level Classification E-value
Superfamily TB module/8-cys domain 7.72e-21
Family TB module/8-cys domain 0.0000384
Further Details:      
 
Domain Number 2 Region: 470-538
Classification Level Classification E-value
Superfamily TB module/8-cys domain 1.96e-20
Family TB module/8-cys domain 0.00056
Further Details:      
 
Domain Number 3 Region: 1399-1458
Classification Level Classification E-value
Superfamily TB module/8-cys domain 4.71e-16
Family TB module/8-cys domain 0.0015
Further Details:      
 
Domain Number 4 Region: 777-900
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000659
Family Growth factor receptor domain 0.016
Further Details:      
 
Domain Number 5 Region: 1541-1637
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000157
Family Growth factor receptor domain 0.019
Further Details:      
 
Domain Number 6 Region: 656-782
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000659
Family Growth factor receptor domain 0.015
Further Details:      
 
Domain Number 7 Region: 418-465
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000383
Family EGF-type module 0.0073
Further Details:      
 
Domain Number 8 Region: 1041-1160
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000455
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number 9 Region: 930-1037
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000157
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number 10 Region: 364-420
Classification Level Classification E-value
Superfamily TB module/8-cys domain 0.00000000366
Family TB module/8-cys domain 0.005
Further Details:      
 
Domain Number 11 Region: 1340-1388
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000167
Family EGF-type module 0.0091
Further Details:      
 
Domain Number 12 Region: 1302-1352
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000335
Family EGF-type module 0.01
Further Details:      
 
Domain Number 13 Region: 1154-1192
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000231
Family EGF-type module 0.0096
Further Details:      
 
Domain Number 14 Region: 2-40
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000617
Family EGF-type module 0.01
Further Details:      
 
Weak hits

Sequence:  ENSMGAP00000013379
Domain Number - Region: 207-237
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000884
Family EGF-type module 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000013379   Gene: ENSMGAG00000012684   Transcript: ENSMGAT00000014285
Sequence length 1646
Comment pep:novel chromosome:UMD2:5:39456504:39506056:-1 gene:ENSMGAG00000012684 transcript:ENSMGAT00000014285 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VCDPPCQNKGSCSRPHVCTCRSGFQGSRCEEVVPEQEYHPPSIALQPPAGPLRRRTGTAE
RDASPREAQASVPQHAPTRRKNPAAVKSGQKETNPAQAQHTVPSRTVRRYPASNSQLTSN
TLPNGHGHEQGSSGPNAAFQEHTLAARGANLTEKIRKIKIIFTPTICKQTCRNGRCYNSC
EKGDTTTLYSQGGHDHDPKSGFRIYFCQIPCLNGGRCVGRDECWCPSNSTGKFCHMPAPS
PEKKQGGKAPNTMASGSMKHSTYTLPLSNQLASLNPSLVNVHINHPPEATVQIHQVARVR
GDSEVSEENSVEFLAPIGTPVSSLEQLALSKTLVGQSRTLPPLLAQPVPRAAVGSHPIFY
SIPSKCTNPLPGLTLLEDCCGSVGLFWGVDRCLACPPRPAHPVIENGQVECPQGYKRLNR
SHCQDINECLMQGLCKDARCLNTRGSFRCTCRPGTMLDPSRSHCISDKAVSMEQGLCYRS
AAEGVCSFPLSHRITQQICCCSRVGKGWGKNCEECPVPGSGAFKEICPAGHGYTYSSSDI
RLSMRKAEAEELPLSLEEHSESSNWTLDWATRRQRLQDSLHGSVLEALPHPDISAGEATV
LPAHSPQWREGPALTLHLPRPPTLFISTPLWGWGCGEHCRGLQPLAACSLHPGASGCASS
SLACGAGVCVLTPDGYSCSCHQGYMLHPSRLHCIDEDECLQDPCAGKGHCVNSMGSYSCL
CYSGYTLVFLESKQSCQDRDECEQPSTCPGQRCVNTPGSYRCECKEGFAMGLRGQCEDIN
ECMDPSLCPHGKCVNTPGSYRCVSCADGYQPRNGRCIDVDECLVERTCTYGQCINLDGSF
RCSCYRGYEVAADGKSCADIDECAAQSACPSRLCLNTEGSYSCMACDAGYTVSRDGSTCE
GLQEGDFPHSVCSDAVGQRKALHCPLVGGMQCSAGYGQWDCSPVSVILADVDECADLVIQ
CLGGECRNTLGSYECHCQTGFELINGTVCQDVNECLNSEICSPNGECLNSHGSYFCICAP
GFSSSAGGVNCQDVDECTDKSRCSQGQCLNTEGSYRCLCENGFKHSQETDDCIDVDECKE
YGDAICGTWRCQNSLGSYRCIMGCQPGFHWTPLGDCIDIDECANETLCGSHGFCENSDGS
FRCLCDRGYESSPSGHYCVDVNECELMVAVCGTALCENVEGSFLCLCPSDHEEYDTEAGQ
CRPRAAVGEKQLEGPERHTDQPSDSMERKQCYYHISDVRLCDSVLAKNVTKQECCCTVGA
AWGDNCETYPCPILGTVEYQEICPLGKGYVPQEDPLSGKVSFTDMDECETFGSEFCRNGQ
CLNTVPGYKCFCRTGYFYDAGRLECIDQDECQNEVYCINGECLNTVGSYHCFCSLPLVLD
ATGNRCVNLSGRADALEEYEIHLDVCWQTVSDYICQDLLHGEQTTYTECCCRLGEAWGQN
CALCPHRSSADFAFLCNGASEDSDRGAEVRERPRYEYGPGLEDPHYGLPNPDMGPYYNYL
ESEYGNPDAAFPRRELSSEFRGSPFHHGPGRPPPRHLPSQPGLYEGFEGLQAEECGILNG
CENGRCVRVPEGYTCDCFDGYQLDMTLMACVDINECEDVDVPVPLCQGGTCENTEGSYRC
RCLPGYVALAQPHHCVPQTAQSPAAA
Download sequence
Identical sequences G1NJ87
ENSMGAP00000013379 ENSMGAP00000013379

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]