SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000013721 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000013721
Domain Number 1 Region: 5-129
Classification Level Classification E-value
Superfamily PH domain-like 1.86e-22
Family Pleckstrin-homology domain (PH domain) 0.004
Further Details:      
 
Domain Number 2 Region: 460-535
Classification Level Classification E-value
Superfamily SH2 domain 0.000000000105
Family SH2 domain 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000013721   Gene: ENSMGAG00000013006   Transcript: ENSMGAT00000014636
Sequence length 541
Comment pep:novel chromosome:UMD2:4:65940378:65951892:-1 gene:ENSMGAG00000013006 transcript:ENSMGAT00000014636 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASEEQVWPVPMKAIGAQNLLTMPGGVTKSGYLHKKGGTQLQILKWPLRFVIIHEGCIYY
FKTSTSASPQGAFSLNGYNRVMRAAEETTSSNVFPFKLVHISKKHRTWFFSASSEDERKN
WMLSLRREIDHYHDKKETVTEFSDSGSDADSFYGSVERPIDIKYSHHSADNEDYDQEEDD
ESYLQPDTSDIVKDADIMVLPPAYPPPPVPHVRKAAYSESRSHSFSGKTAGSAAPPPPPK
RSLPEIKTEDFFSVREPQLPCRAEPNLKIQSSSRRPSEQLPPVPPLPLFKKPFCVKEPSL
LPPEPLPLSHVLNTPEGCEKLKTLNLSPRTPPPLPSNKPKLSQITEKPVETKVPREHGKP
ALFVPPVLPKPPVPGHQHPVLKPRPEKPSCPQLQRSPPDGQSFRSFSFEKPALPSKPNQA
NDDSDDDYEKVELPTSIFINTSESLEVERIFKATSPKGQPQNGLYCIRNSSTKAGKVLVV
WDQSAEKVRNYRIFEKDCKFYLDADIMFLNMGSLVEYYSTHVLPSHGSLILRCPYGYSKP
R
Download sequence
Identical sequences G1NK11
ENSMGAP00000013721 ENSMGAP00000013721

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]