SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000014070 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000014070
Domain Number 1 Region: 304-519
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 8.77e-61
Family DBL homology domain (DH-domain) 0.00015
Further Details:      
 
Domain Number 2 Region: 502-635
Classification Level Classification E-value
Superfamily PH domain-like 3.08e-33
Family Pleckstrin-homology domain (PH domain) 0.0023
Further Details:      
 
Domain Number 3 Region: 688-850
Classification Level Classification E-value
Superfamily PH domain-like 1.05e-22
Family Pleckstrin-homology domain (PH domain) 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000014070   Gene: ENSMGAG00000013316   Transcript: ENSMGAT00000014991
Sequence length 877
Comment pep:novel chromosome:UMD2:1:60258138:60296476:-1 gene:ENSMGAG00000013316 transcript:ENSMGAT00000014991 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KSFNVYKTNNFHTRTHPKVCSLCEYISKYFSGNSICPKSLILSRSCPASATTRLVEQNVH
NEAAQGINGSVPVKQSPRSASNPKPQVPPKPLHLQKLSPVTYQTSRHKALSSSKPRMEED
TPTPVSSVTKEKSNKVSDLIHRFEGCRYVIPFSPIDLKKDSSALNVSKSQGRYGSTPPPQ
PKLPSQHPLLKQGNSNTDKTQVAQTHTANGVVTQDQVDREDRRILDRGSTVSTLVPDNSI
NSSLINGERVSTSRDSLETTTSYEGSVLNSCYRTPSSDTLLPSDNEINTNVEEELNEEMI
KQDQPAETKETDEQKRHKIASELLQTEKAYVSRLGLLDQVFYSRLLEEANRGSFPAEVIN
KIFSNISSINAFHSKFLLPELEKRMQEWTTTPRIGDILQKLAPFLKMYGEYVKNFDNAME
LVKTWTERSPQFKFIIQEIQKEKVCGSLTLQHHMLEPVQRIPRYEMLLKDYLRKLPQDSL
DWKDAEKSLEIISTAASHSNSAIRKMENLKKLLEIYEMLGEEEDIVNPSNELIKEGQILK
LAARNTSAQERHLFLFNNMLLYCVPKFSLVGSKFSVRTRVGIDGMKIIETHNEEYPHTFQ
VSGKERTLELQASSEQDKEEWIKALQNTIEAFQQRNETFRNAIAKEEYEDMPVEVSNAEL
GKRAPRWIRDNEVTMCMKCKEPFNALTRRRHHCRACGHVVCWKCSDYKAHLEYDGNKLNK
VCKDCYHVIIGCTDSEEKKKKGILEIESAEVSGNSVICSFLQYMEKSKPWQKAWCVIPKQ
EAVVLYMYGAPQDVKALATIPLLGYTVDDTPRSADLPHSFKLTQSKSVHSFAADNEELKQ
KWLKVIHLAVKGETSECQNELQVNLEEQPESSKTSEC
Download sequence
Identical sequences G1NKT5
ENSMGAP00000014070 ENSMGAP00000014070

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]