SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000014145 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000014145
Domain Number 1 Region: 228-504
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 9.43e-83
Family Protein kinases, catalytic subunit 0.0000000387
Further Details:      
 
Domain Number 2 Region: 125-268
Classification Level Classification E-value
Superfamily SH2 domain 4.01e-39
Family SH2 domain 0.000037
Further Details:      
 
Domain Number 3 Region: 58-150
Classification Level Classification E-value
Superfamily SH3-domain 1.87e-20
Family SH3-domain 0.00043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000014145   Gene: ENSMGAG00000013388   Transcript: ENSMGAT00000015068
Sequence length 518
Comment pep:novel chromosome:UMD2:2:66195327:66237699:1 gene:ENSMGAG00000013388 transcript:ENSMGAT00000015068 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGNFCQKYCSCLEPYVPCLFSGKEDEREEDVGQVFANPAVVRIGSQAGEKDKHLVSTCNF
VALFNYEARTEDDLSFQAGDKLEVLDASHEGWWYAKLLLPEGSVCPGRKLQGYIPANYIA
AVQSIEAEPWFFGPIKRADAERQLLYPGNQAGAFLIRESESLKGEYSLSVFDGESVKHYR
IRRLDGEGFFLSKLKTFKTLNEFVDYYSKNSNGLCVMLGKPCPKVQIPTTFDLSYKTVDQ
WEIDRKSLKFLKKLGSGQFGEVWEGLWNNTTPVAIKTLKPGSMDPKDFLREAQIMKNLRH
PKLIQLYAVCTLEDPIYIVTELMKYGSLIEYLQNDAGSHISLPHQIDMAAQVASGMAYLE
SQNYIHRDLAARNVLVGEHNVYKVADFGLARVFKVENENIYEARPETKLPVKWTAPEAIR
YSKFSVKSDVWSFGVLVFEIMTYGKMPYAGMPGHQVIQMLDKGYRLPQPETCPKALYELM
LKCWSTEPSERPTFEALYCQLEDYFDNDSYMDKHATIK
Download sequence
Identical sequences G1NKZ9
ENSMGAP00000014145 ENSMGAP00000014145

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]