SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000014352 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000014352
Domain Number 1 Region: 576-925
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.63e-91
Family Phoshoinositide 3-kinase (PI3K), catalytic domain 0.000000466
Further Details:      
 
Domain Number 2 Region: 392-571
Classification Level Classification E-value
Superfamily ARM repeat 1.97e-47
Family Phoshoinositide 3-kinase (PI3K) helical domain 0.0011
Further Details:      
 
Domain Number 3 Region: 246-381
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 3.27e-21
Family PLC-like (P variant) 0.052
Further Details:      
 
Domain Number 4 Region: 966-1060
Classification Level Classification E-value
Superfamily PX domain 7.59e-18
Family PX domain 0.003
Further Details:      
 
Domain Number 5 Region: 1082-1195
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.00000000000000103
Family Synaptotagmin-like (S variant) 0.0099
Further Details:      
 
Domain Number 6 Region: 7-71
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000284
Family Ras-binding domain, RBD 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000014352   Gene: ENSMGAG00000013577   Transcript: ENSMGAT00000015283
Sequence length 1198
Comment pep:novel chromosome:UMD2:1:65609210:65802164:1 gene:ENSMGAG00000013577 transcript:ENSMGAT00000015283 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AGCITHDLIVEILRCTNQYPVHEECLLSVCGSDEFLQNNHSLGSHESLRKATTDIHLHLH
TTTNLKQSLARMHEDDQGQFSVNELLEYTCAWRLTRQNLVAALRKYRGQVEHVLQNEDNL
CFTEKPLTELLSPQPHKVDYVIEVAKAICSVLCFVETREITNAVKKLRAVPLVKTQNFHK
ISDTEIISLTEAAVTELSMAISHLIHVYSNSFDMDFQVASVPRSPSRADISLDSQLSFTV
YAAHNIPEAWVNRYKLFSFSCLLTYAGKTICQVKICKNIPVRKSFFFLTDWNEKINFPLR
IKALPRETMLTIKLLGLNGASKTIEVLAWTCCPLYQKEQLIHGTVLLSMKLYSMLPAALI
TPGICSADAPTSVTLQIEFPEADLEFINPEPEERRDDLEEPTEECLKHIAKLSQAHSLLL
LSEQQRRILWFYRYYCNNQNCSLSLVLGSAPSWDRTTVSEIYSVMRKWRFSNPLEALGLL
TFSFPDKDIRRTAVQQIENLSNDELLEYLPQLVQVLKFEWSLEGPLVKLLLNRSLQSIQI
AHQLYWLLKNAQNEVHFKIWYRKLLAALQFTAGKTLNNEFSKEEKLIRILEDIAEKVKAA
SDMKRKEVLKMELNRLQQFFQDVKVCRLPLNPALVVQGIEADSCSYFTSNAFPLKISFIN
ANAPSGNINIIFKIGDDLRQDMLVLQIIRVIDNIWLQEGLDMQMIIYRCLSTGKGQGLVQ
MVPDATTLAKIHRESGLIGPLKENTIKKWFRHHHRLESSYQEAIRNFFHSCAGWCVVTFI
LGVCDRHNDNIMLTNAGHMFHIDFGRFLGHAQTFGSIRRDRAPFIFTSEMEYFITEGGKN
PQRFQEFVELCCRAYNIVRKHSQLLLNLLEMMLHAGLPELNRIQDLKYVYDNLRPQDSDL
QATSYFTRKIKESLECFPVRLNNLIHTLAHMSLTGSAKLPSQETVPQEWMMLNVEKSIAR
ATILGFNKKSDYLYLVQVVQTCNVVTFVEKSFDQFSELHSNLQKQFPSHALPEFPHSWYI
AFIDLEHKRVKDLNLYLKQLLSGSRKLANNELVLSFFLNWSKHTLAEKASSVTSGPQSND
GTPGVQLVISYEDTRLTVMLKHMRNIRLPDGSAPSAHAEFYLLPDPDEVNQRKTRTVPKT
TNPTYNEIVVYNKVMQLEGHILKLVVKSKGTFVGAVNIQLSRVRLNEEKWYPLGNSVI
Download sequence
Identical sequences G1NLF8
ENSMGAP00000014352 ENSMGAP00000014352

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]