SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000014804 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000014804
Domain Number 1 Region: 54-192
Classification Level Classification E-value
Superfamily PH domain-like 0.00000541
Family Phosphotyrosine-binding domain (PTB) 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000014804   Gene: ENSMGAG00000013993   Transcript: ENSMGAT00000015744
Sequence length 200
Comment pep:novel chromosome:UMD2:2:101042728:101049535:-1 gene:ENSMGAG00000013993 transcript:ENSMGAT00000015744 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFRKGKKRHSSSSSQSSEISTKSKSVDSSLGGLSRSSTVASLDTDSTKSSGQSNSNSDTC
AEFRVKYVGAIEKLKHNESKNLEGPLDLINYIDVAQQDGKLPFVPGEEEFIMGVSKYGIK
VSTSDQYDVLHRHALYLIVRMVCYDDGLGAGKSLLALKTTDAASEECSLWVYQCSSLEQA
QAICKVLSTAFDSVLMSEKS
Download sequence
Identical sequences G1NMJ0
NP_001264964.1.86415 XP_003204529.1.16129 XP_015131522.1.86415 ENSMGAP00000014804 ENSGALP00000026439 ENSMGAP00000014804 9031.ENSGALP00000026439 ENSGALP00000026439

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]